Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A067TQZ4

Protein Details
Accession A0A067TQZ4    Localization Confidence High Confidence Score 15.9
NoLS Segment(s)
PositionSequenceProtein Nature
105-132STEAYISSRSCRRRKKKRLLLLPPVPVMHydrophilic
NLS Segment(s)
PositionSequence
59-84RLKAQKKAAANAKKPKESAASLAKRK
116-122RRRKKKR
Subcellular Location(s) nucl 21.5, mito_nucl 12, cyto 3
Family & Domain DBs
InterPro View protein in InterPro  
IPR007513  SERF-like_N  
Pfam View protein in Pfam  
PF04419  4F5  
Amino Acid Sequences MVPANLDLECHDTQMGIPDLTSLSTSVSSKGIKIKVTPVVVALTFRDPKNRGNQRDQDRLKAQKKAAANAKKPKESAASLAKRKEADAEVLRAKQKVRVTSGLSSTEAYISSRSCRRRKKKRLLLLPPVPVMASAGIRIRLG
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.18
2 0.19
3 0.13
4 0.13
5 0.12
6 0.13
7 0.13
8 0.13
9 0.08
10 0.07
11 0.09
12 0.1
13 0.1
14 0.13
15 0.13
16 0.15
17 0.21
18 0.23
19 0.23
20 0.24
21 0.27
22 0.3
23 0.31
24 0.29
25 0.24
26 0.23
27 0.21
28 0.2
29 0.17
30 0.15
31 0.17
32 0.18
33 0.23
34 0.23
35 0.27
36 0.37
37 0.45
38 0.47
39 0.52
40 0.61
41 0.62
42 0.71
43 0.69
44 0.65
45 0.62
46 0.65
47 0.61
48 0.59
49 0.52
50 0.46
51 0.46
52 0.45
53 0.48
54 0.46
55 0.49
56 0.52
57 0.56
58 0.54
59 0.53
60 0.48
61 0.42
62 0.35
63 0.33
64 0.33
65 0.36
66 0.38
67 0.39
68 0.4
69 0.37
70 0.36
71 0.34
72 0.25
73 0.23
74 0.21
75 0.23
76 0.24
77 0.26
78 0.28
79 0.27
80 0.26
81 0.26
82 0.27
83 0.28
84 0.29
85 0.31
86 0.33
87 0.35
88 0.38
89 0.35
90 0.32
91 0.28
92 0.24
93 0.2
94 0.16
95 0.14
96 0.12
97 0.11
98 0.15
99 0.22
100 0.3
101 0.39
102 0.5
103 0.6
104 0.7
105 0.8
106 0.87
107 0.9
108 0.92
109 0.94
110 0.94
111 0.94
112 0.91
113 0.86
114 0.75
115 0.65
116 0.54
117 0.43
118 0.33
119 0.24
120 0.16
121 0.12
122 0.13