Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A067S9C2

Protein Details
Accession A0A067S9C2    Localization Confidence Low Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
28-50LKTDTKIQYNAKRRHWRRTKLNIHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 14, mito_nucl 12.833, mito 10.5, cyto_nucl 8.833
Family & Domain DBs
InterPro View protein in InterPro  
IPR000077  Ribosomal_L39  
IPR020083  Ribosomal_L39_CS  
IPR023626  Ribosomal_L39e_dom_sf  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF00832  Ribosomal_L39  
PROSITE View protein in PROSITE  
PS00051  RIBOSOMAL_L39E  
Amino Acid Sequences PSQKTFRTKRILAKAGRQNRPIPQWFRLKTDTKIQYNAKRRHWRRTKLNI
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.73
2 0.74
3 0.75
4 0.69
5 0.63
6 0.6
7 0.63
8 0.6
9 0.54
10 0.5
11 0.52
12 0.5
13 0.51
14 0.51
15 0.48
16 0.43
17 0.49
18 0.51
19 0.45
20 0.5
21 0.53
22 0.57
23 0.64
24 0.69
25 0.7
26 0.73
27 0.76
28 0.8
29 0.83
30 0.84