Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A067THR7

Protein Details
Accession A0A067THR7    Localization Confidence High Confidence Score 16.8
NoLS Segment(s)
PositionSequenceProtein Nature
52-71IRRKEMKYIREAKKHPRSRYBasic
NLS Segment(s)
PositionSequence
54-70RKEMKYIREAKKHPRSR
Subcellular Location(s) nucl 22, mito 3
Family & Domain DBs
Amino Acid Sequences MQCADSFEREKYNRVSDLTQLSIRDVVDLCPGLPHGTAATLLSYAKKDTDAIRRKEMKYIREAKKHPRSRY
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.39
2 0.38
3 0.34
4 0.36
5 0.35
6 0.32
7 0.27
8 0.25
9 0.23
10 0.21
11 0.18
12 0.14
13 0.11
14 0.11
15 0.11
16 0.1
17 0.08
18 0.09
19 0.08
20 0.07
21 0.07
22 0.05
23 0.05
24 0.05
25 0.05
26 0.05
27 0.05
28 0.05
29 0.06
30 0.07
31 0.07
32 0.07
33 0.08
34 0.09
35 0.14
36 0.24
37 0.32
38 0.37
39 0.46
40 0.53
41 0.53
42 0.6
43 0.62
44 0.57
45 0.58
46 0.64
47 0.64
48 0.66
49 0.72
50 0.74
51 0.79