Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A067T215

Protein Details
Accession A0A067T215   
Localization Confidence High
Confidence Score 17.2
NoLS Segment(s)
PositionSequenceProtein Nature
221-240GKINKEYKGKFSRKRLNEEEBasic
NLS Segment(s)
PositionSequence
119-126KLARKKRR
Subcellular Location(s) nucl 24, cyto 2
Family & Domain DBs
InterPro View protein in InterPro  
IPR013260  mRNA_splic_SYF2  
Gene Ontology GO:0005681  C:spliceosomal complex  
GO:0000398  P:mRNA splicing, via spliceosome  
Pfam View protein in Pfam  
PF08231  SYF2  
Amino Acid Sequences MTGIEENNSSSSKSGAATPAEGGAEVKEEIQKMTIEERRAKLDELRKKMAASSKANRSSLVNEAAKAKVTARDAARLERQRKLAETLRLKADAEDRGEDVERQKNWEYTIEENDEWEKKLARKKRRADFEFHDDAHAARRRYKKDLDHIKPDLVAYNKQKAIAMGLNSGSLVGFNPEAGSSELAAISQEQKLAAENLYRDANTLIYGDSKPSEDAIDRVVGKINKEYKGKFSRKRLNEEEGDITYINEHNRVFNKKIARYYDKYTAEIRASFERGTAL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.15
2 0.17
3 0.18
4 0.19
5 0.19
6 0.19
7 0.18
8 0.17
9 0.15
10 0.11
11 0.11
12 0.1
13 0.1
14 0.12
15 0.12
16 0.13
17 0.14
18 0.14
19 0.14
20 0.22
21 0.25
22 0.29
23 0.35
24 0.37
25 0.42
26 0.43
27 0.44
28 0.44
29 0.49
30 0.52
31 0.53
32 0.56
33 0.52
34 0.5
35 0.53
36 0.52
37 0.51
38 0.5
39 0.5
40 0.54
41 0.59
42 0.59
43 0.56
44 0.5
45 0.46
46 0.42
47 0.41
48 0.32
49 0.27
50 0.29
51 0.28
52 0.27
53 0.24
54 0.21
55 0.18
56 0.18
57 0.23
58 0.22
59 0.27
60 0.28
61 0.32
62 0.4
63 0.44
64 0.46
65 0.46
66 0.49
67 0.44
68 0.45
69 0.46
70 0.44
71 0.44
72 0.46
73 0.44
74 0.44
75 0.42
76 0.4
77 0.36
78 0.33
79 0.27
80 0.23
81 0.21
82 0.18
83 0.18
84 0.19
85 0.18
86 0.19
87 0.21
88 0.19
89 0.23
90 0.24
91 0.24
92 0.25
93 0.27
94 0.26
95 0.23
96 0.27
97 0.26
98 0.24
99 0.23
100 0.25
101 0.22
102 0.2
103 0.18
104 0.16
105 0.17
106 0.25
107 0.32
108 0.4
109 0.49
110 0.57
111 0.65
112 0.73
113 0.72
114 0.72
115 0.69
116 0.67
117 0.62
118 0.53
119 0.45
120 0.34
121 0.31
122 0.31
123 0.29
124 0.22
125 0.24
126 0.3
127 0.33
128 0.38
129 0.44
130 0.42
131 0.48
132 0.58
133 0.58
134 0.59
135 0.58
136 0.53
137 0.48
138 0.42
139 0.35
140 0.26
141 0.26
142 0.22
143 0.26
144 0.26
145 0.26
146 0.26
147 0.23
148 0.23
149 0.2
150 0.17
151 0.13
152 0.12
153 0.12
154 0.11
155 0.11
156 0.08
157 0.06
158 0.05
159 0.04
160 0.04
161 0.04
162 0.04
163 0.04
164 0.06
165 0.07
166 0.07
167 0.06
168 0.07
169 0.07
170 0.07
171 0.07
172 0.06
173 0.07
174 0.07
175 0.07
176 0.07
177 0.07
178 0.08
179 0.09
180 0.09
181 0.1
182 0.1
183 0.12
184 0.14
185 0.13
186 0.13
187 0.13
188 0.12
189 0.1
190 0.1
191 0.08
192 0.09
193 0.1
194 0.1
195 0.11
196 0.12
197 0.11
198 0.12
199 0.13
200 0.11
201 0.12
202 0.12
203 0.16
204 0.15
205 0.15
206 0.2
207 0.2
208 0.21
209 0.28
210 0.31
211 0.34
212 0.39
213 0.4
214 0.44
215 0.54
216 0.62
217 0.64
218 0.69
219 0.73
220 0.75
221 0.83
222 0.8
223 0.77
224 0.72
225 0.67
226 0.61
227 0.52
228 0.47
229 0.37
230 0.31
231 0.24
232 0.22
233 0.18
234 0.17
235 0.16
236 0.19
237 0.25
238 0.32
239 0.33
240 0.37
241 0.45
242 0.48
243 0.56
244 0.59
245 0.62
246 0.61
247 0.65
248 0.69
249 0.63
250 0.6
251 0.55
252 0.52
253 0.47
254 0.43
255 0.4
256 0.36
257 0.35
258 0.32