Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A067T5Q1

Protein Details
Accession A0A067T5Q1    Localization Confidence Low Confidence Score 9
NoLS Segment(s)
PositionSequenceProtein Nature
104-125DSPTSPRRPLCWRRRCRRGRIAHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 18.5, cyto_nucl 12.333, mito_nucl 11.666, cyto 4
Family & Domain DBs
Amino Acid Sequences MDKKKRATTMEHRTTWTTNNYNSKLVGLQLHVRSDDEKKNCSNGVLRSSYSHDVMNPQHYLKTSPSIWSPRAVLPGSILAGDEDAEGEMEVDIETFSGPSFNSDSPTSPRRPLCWRRRCRRGRIA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.59
2 0.55
3 0.52
4 0.46
5 0.43
6 0.49
7 0.49
8 0.47
9 0.45
10 0.41
11 0.34
12 0.3
13 0.25
14 0.18
15 0.21
16 0.22
17 0.23
18 0.22
19 0.22
20 0.23
21 0.26
22 0.32
23 0.29
24 0.3
25 0.3
26 0.33
27 0.33
28 0.32
29 0.32
30 0.27
31 0.29
32 0.28
33 0.27
34 0.25
35 0.29
36 0.29
37 0.26
38 0.22
39 0.17
40 0.19
41 0.2
42 0.21
43 0.18
44 0.17
45 0.17
46 0.17
47 0.19
48 0.16
49 0.18
50 0.15
51 0.15
52 0.18
53 0.21
54 0.22
55 0.21
56 0.22
57 0.19
58 0.23
59 0.21
60 0.18
61 0.15
62 0.14
63 0.13
64 0.11
65 0.1
66 0.06
67 0.06
68 0.06
69 0.05
70 0.04
71 0.04
72 0.04
73 0.04
74 0.04
75 0.04
76 0.04
77 0.04
78 0.04
79 0.03
80 0.03
81 0.04
82 0.03
83 0.04
84 0.04
85 0.04
86 0.06
87 0.1
88 0.1
89 0.14
90 0.15
91 0.18
92 0.24
93 0.3
94 0.32
95 0.37
96 0.4
97 0.42
98 0.51
99 0.59
100 0.64
101 0.69
102 0.76
103 0.8
104 0.88
105 0.92