Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A067TFV2

Protein Details
Accession A0A067TFV2    Localization Confidence Medium Confidence Score 10.8
NoLS Segment(s)
PositionSequenceProtein Nature
312-344FQAAKDFDKERKKCRGKKPKKVNGSPAKPSPNKBasic
395-420DDDEIDQPPPRKKQKKLHNPIIEIYDHydrophilic
NLS Segment(s)
PositionSequence
320-342KERKKCRGKKPKKVNGSPAKPSP
Subcellular Location(s) cyto 11.5, cyto_nucl 7.5, mito 7, nucl 2.5, extr 2, pero 2
Family & Domain DBs
InterPro View protein in InterPro  
IPR045341  DUF6532  
Pfam View protein in Pfam  
PF20149  DUF6532  
CDD cd21075  DBD_XPA-like  
Amino Acid Sequences MATAAASTASAPALALTTGAELKDPQFAEGYRAGGKAKAGDYEPVVCALLLRAMREYEAMVSTKDAFPDLLVRGEWARTCWQRAGNQFNERYQLTARMSSLIGKRGSRVRSELLGIVRNQVASFYGFNLNTTPRAIDHNRLLAAKLLSGSAFHHKDPDAKTGYGQSGIISNLIHLGWFDSGEESAGIVYSSLFNPISLETLALLFTLIEFCLKEWSSGKRTPAKFFEKAIKAAHEAHRLDLKSWNDLNVQPELEQMTMNKGVGKAAYLLNDVDLVNLPFVEYQTGVGWLAKNYLEQQLELCAWQKYGGPTGFQAAKDFDKERKKCRGKKPKKVNGSPAKPSPNKSEYKVARPTNSVLPNSLSVTKSTPSQPTAFPNLPVNCGPSHKPFDVLELSDDDEIDQPPPRKKQKKLHNPIIEIYDVIDISD
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.06
2 0.06
3 0.05
4 0.07
5 0.09
6 0.09
7 0.09
8 0.1
9 0.11
10 0.17
11 0.17
12 0.17
13 0.18
14 0.19
15 0.23
16 0.23
17 0.25
18 0.21
19 0.23
20 0.22
21 0.21
22 0.22
23 0.22
24 0.21
25 0.21
26 0.21
27 0.22
28 0.24
29 0.25
30 0.24
31 0.21
32 0.2
33 0.16
34 0.15
35 0.13
36 0.15
37 0.12
38 0.13
39 0.13
40 0.14
41 0.14
42 0.15
43 0.15
44 0.12
45 0.14
46 0.14
47 0.13
48 0.14
49 0.16
50 0.17
51 0.16
52 0.15
53 0.13
54 0.12
55 0.16
56 0.16
57 0.15
58 0.14
59 0.15
60 0.15
61 0.17
62 0.17
63 0.16
64 0.22
65 0.24
66 0.28
67 0.31
68 0.35
69 0.39
70 0.47
71 0.53
72 0.53
73 0.57
74 0.57
75 0.55
76 0.54
77 0.48
78 0.43
79 0.35
80 0.34
81 0.28
82 0.27
83 0.25
84 0.23
85 0.23
86 0.26
87 0.27
88 0.27
89 0.28
90 0.25
91 0.29
92 0.34
93 0.36
94 0.34
95 0.35
96 0.32
97 0.31
98 0.33
99 0.33
100 0.29
101 0.3
102 0.27
103 0.26
104 0.23
105 0.21
106 0.19
107 0.15
108 0.13
109 0.11
110 0.11
111 0.1
112 0.14
113 0.14
114 0.15
115 0.16
116 0.17
117 0.16
118 0.16
119 0.15
120 0.11
121 0.18
122 0.2
123 0.23
124 0.25
125 0.28
126 0.29
127 0.29
128 0.28
129 0.25
130 0.23
131 0.18
132 0.15
133 0.11
134 0.1
135 0.1
136 0.11
137 0.15
138 0.17
139 0.16
140 0.19
141 0.19
142 0.25
143 0.27
144 0.31
145 0.28
146 0.26
147 0.27
148 0.27
149 0.27
150 0.23
151 0.2
152 0.14
153 0.11
154 0.11
155 0.11
156 0.08
157 0.07
158 0.07
159 0.07
160 0.06
161 0.05
162 0.05
163 0.05
164 0.05
165 0.05
166 0.05
167 0.05
168 0.05
169 0.05
170 0.04
171 0.04
172 0.04
173 0.03
174 0.03
175 0.03
176 0.04
177 0.04
178 0.06
179 0.06
180 0.06
181 0.06
182 0.07
183 0.08
184 0.07
185 0.07
186 0.05
187 0.06
188 0.06
189 0.05
190 0.05
191 0.03
192 0.03
193 0.03
194 0.03
195 0.03
196 0.03
197 0.04
198 0.07
199 0.07
200 0.08
201 0.1
202 0.15
203 0.2
204 0.23
205 0.28
206 0.34
207 0.36
208 0.4
209 0.45
210 0.47
211 0.44
212 0.43
213 0.47
214 0.41
215 0.41
216 0.38
217 0.33
218 0.28
219 0.31
220 0.33
221 0.32
222 0.29
223 0.28
224 0.31
225 0.3
226 0.28
227 0.3
228 0.26
229 0.24
230 0.24
231 0.24
232 0.22
233 0.23
234 0.24
235 0.2
236 0.19
237 0.14
238 0.14
239 0.14
240 0.12
241 0.1
242 0.08
243 0.1
244 0.1
245 0.11
246 0.11
247 0.1
248 0.1
249 0.1
250 0.1
251 0.09
252 0.09
253 0.1
254 0.1
255 0.1
256 0.09
257 0.1
258 0.1
259 0.08
260 0.08
261 0.07
262 0.06
263 0.06
264 0.06
265 0.05
266 0.05
267 0.06
268 0.05
269 0.06
270 0.06
271 0.07
272 0.07
273 0.08
274 0.09
275 0.08
276 0.1
277 0.09
278 0.1
279 0.11
280 0.16
281 0.15
282 0.15
283 0.15
284 0.15
285 0.16
286 0.16
287 0.16
288 0.11
289 0.11
290 0.11
291 0.13
292 0.12
293 0.18
294 0.18
295 0.18
296 0.18
297 0.22
298 0.24
299 0.22
300 0.22
301 0.19
302 0.2
303 0.23
304 0.25
305 0.28
306 0.36
307 0.42
308 0.48
309 0.57
310 0.66
311 0.72
312 0.8
313 0.84
314 0.85
315 0.9
316 0.94
317 0.93
318 0.93
319 0.93
320 0.92
321 0.92
322 0.89
323 0.85
324 0.82
325 0.81
326 0.75
327 0.7
328 0.68
329 0.64
330 0.6
331 0.57
332 0.59
333 0.55
334 0.59
335 0.64
336 0.61
337 0.58
338 0.57
339 0.57
340 0.55
341 0.56
342 0.48
343 0.41
344 0.37
345 0.35
346 0.35
347 0.35
348 0.27
349 0.22
350 0.23
351 0.22
352 0.24
353 0.26
354 0.28
355 0.28
356 0.3
357 0.32
358 0.36
359 0.43
360 0.41
361 0.39
362 0.42
363 0.4
364 0.41
365 0.38
366 0.35
367 0.29
368 0.32
369 0.34
370 0.33
371 0.38
372 0.35
373 0.38
374 0.35
375 0.39
376 0.39
377 0.36
378 0.31
379 0.26
380 0.27
381 0.23
382 0.23
383 0.18
384 0.16
385 0.15
386 0.15
387 0.19
388 0.23
389 0.3
390 0.4
391 0.5
392 0.58
393 0.67
394 0.76
395 0.81
396 0.87
397 0.9
398 0.92
399 0.91
400 0.86
401 0.81
402 0.75
403 0.64
404 0.53
405 0.43
406 0.34