Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A067T071

Protein Details
Accession A0A067T071    Localization Confidence Medium Confidence Score 12.1
NoLS Segment(s)
PositionSequenceProtein Nature
160-192PAEIHPSRPDRPKPSRKKPYDAKPQRPEPWPRIBasic
NLS Segment(s)
PositionSequence
165-184PSRPDRPKPSRKKPYDAKPQ
Subcellular Location(s) nucl 13.5, mito 11, cyto_nucl 8.5
Family & Domain DBs
Amino Acid Sequences MSVSQRGRSASVPHSRPPTSASTYAPSRLRPDDDDRPHIAGPAECLCPACHLKTNFFPRRQDGRIVLPPPNPTRLAEGQPHVVGSSVSMSMSSHGAREAREAEVPMRRLDIGEGTSAGSGQLSGPGVPAGAPEDWTHLPPLLRDFELPYLMGRGTPRMPPAEIHPSRPDRPKPSRKKPYDAKPQRPEPWPRISSSGFDQIQPVGRSRSRTGEYYFYEMLVANTR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.53
2 0.52
3 0.5
4 0.48
5 0.46
6 0.43
7 0.42
8 0.38
9 0.37
10 0.39
11 0.44
12 0.43
13 0.39
14 0.38
15 0.39
16 0.4
17 0.4
18 0.45
19 0.49
20 0.53
21 0.56
22 0.54
23 0.53
24 0.49
25 0.45
26 0.39
27 0.29
28 0.26
29 0.23
30 0.21
31 0.17
32 0.18
33 0.17
34 0.19
35 0.22
36 0.21
37 0.24
38 0.25
39 0.29
40 0.37
41 0.48
42 0.52
43 0.55
44 0.57
45 0.57
46 0.63
47 0.61
48 0.58
49 0.51
50 0.49
51 0.51
52 0.5
53 0.46
54 0.42
55 0.45
56 0.42
57 0.42
58 0.36
59 0.29
60 0.32
61 0.31
62 0.32
63 0.29
64 0.29
65 0.28
66 0.26
67 0.26
68 0.2
69 0.17
70 0.12
71 0.09
72 0.08
73 0.06
74 0.05
75 0.05
76 0.05
77 0.06
78 0.07
79 0.07
80 0.06
81 0.07
82 0.08
83 0.09
84 0.11
85 0.11
86 0.11
87 0.11
88 0.12
89 0.13
90 0.16
91 0.17
92 0.15
93 0.15
94 0.13
95 0.13
96 0.12
97 0.11
98 0.08
99 0.07
100 0.07
101 0.07
102 0.06
103 0.06
104 0.06
105 0.04
106 0.04
107 0.03
108 0.04
109 0.04
110 0.04
111 0.04
112 0.04
113 0.04
114 0.04
115 0.04
116 0.05
117 0.05
118 0.06
119 0.06
120 0.1
121 0.11
122 0.12
123 0.12
124 0.12
125 0.12
126 0.12
127 0.14
128 0.13
129 0.13
130 0.13
131 0.14
132 0.15
133 0.15
134 0.15
135 0.12
136 0.11
137 0.1
138 0.11
139 0.1
140 0.11
141 0.12
142 0.14
143 0.16
144 0.17
145 0.18
146 0.18
147 0.23
148 0.31
149 0.31
150 0.33
151 0.39
152 0.43
153 0.48
154 0.55
155 0.57
156 0.56
157 0.66
158 0.72
159 0.75
160 0.81
161 0.86
162 0.85
163 0.88
164 0.88
165 0.88
166 0.88
167 0.88
168 0.88
169 0.86
170 0.88
171 0.85
172 0.84
173 0.82
174 0.77
175 0.76
176 0.68
177 0.61
178 0.58
179 0.53
180 0.48
181 0.44
182 0.46
183 0.36
184 0.34
185 0.33
186 0.29
187 0.34
188 0.32
189 0.3
190 0.27
191 0.3
192 0.34
193 0.37
194 0.42
195 0.4
196 0.42
197 0.44
198 0.45
199 0.46
200 0.47
201 0.44
202 0.36
203 0.34
204 0.3