Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

B6QBZ9

Protein Details
Accession B6QBZ9    Localization Confidence Low Confidence Score 9.4
NoLS Segment(s)
PositionSequenceProtein Nature
1-30MRFRDIKDSKQKERKKERKKMFGMFRRIYEBasic
NLS Segment(s)
PositionSequence
9-20SKQKERKKERKK
Subcellular Location(s) mito 14, cyto_nucl 5, nucl 4.5, cyto 4.5, pero 4
Family & Domain DBs
InterPro View protein in InterPro  
IPR000683  Gfo/Idh/MocA-like_OxRdtase_N  
IPR036291  NAD(P)-bd_dom_sf  
Gene Ontology GO:0000166  F:nucleotide binding  
KEGG tmf:PMAA_075900  -  
Pfam View protein in Pfam  
PF01408  GFO_IDH_MocA  
Amino Acid Sequences MRFRDIKDSKQKERKKERKKMFGMFRRIYESFISPPEVPKTDNALRFGLLGASDIAPMSLLRPAKTHPEVIIACVAARDRARAEEYAKKHGIEGVHDSYQDVLNDPSIDCIYIPLPNSHHYEWAIRAIAAGKHVLLEKPSTSNGAEAKKLFEHPVVTAPNAPVLLEAFHYPFHPTWQTFMQLIHNDPLAGPVKSAASYFSTPRGYFGKDDIRFRYALSGGCNMDLATYCVSQIRQILGDSRPKVESVTFRTLSKSEHPENEVEDLEQIDEAVTATFKSKTGAVGRIGSDFALTGTFLGMKVPKLEWAKCIAELEEKEVSGEEEEGKQTKLGDGEKHYVQRMVTLYNHIGPVVYHSIVVEDKHSIKRDGTTTVKSWTQKNTIKAYDWPDKSDGRQGGASWSTYRYQLEEFVNRVKGRKGTGVWVEHQSSMDQMAVLDEMYEKGGLKVRPSRAVEVEG
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.9
2 0.91
3 0.92
4 0.92
5 0.92
6 0.93
7 0.92
8 0.92
9 0.91
10 0.9
11 0.84
12 0.78
13 0.74
14 0.65
15 0.58
16 0.5
17 0.44
18 0.36
19 0.34
20 0.34
21 0.28
22 0.31
23 0.34
24 0.33
25 0.31
26 0.3
27 0.36
28 0.39
29 0.42
30 0.42
31 0.37
32 0.36
33 0.34
34 0.31
35 0.24
36 0.16
37 0.12
38 0.11
39 0.09
40 0.09
41 0.09
42 0.08
43 0.07
44 0.07
45 0.07
46 0.1
47 0.12
48 0.12
49 0.14
50 0.17
51 0.25
52 0.29
53 0.31
54 0.27
55 0.33
56 0.33
57 0.33
58 0.33
59 0.24
60 0.21
61 0.2
62 0.19
63 0.15
64 0.15
65 0.16
66 0.14
67 0.18
68 0.21
69 0.22
70 0.27
71 0.31
72 0.35
73 0.41
74 0.42
75 0.39
76 0.37
77 0.37
78 0.33
79 0.28
80 0.31
81 0.27
82 0.26
83 0.26
84 0.26
85 0.24
86 0.24
87 0.21
88 0.16
89 0.11
90 0.11
91 0.12
92 0.11
93 0.12
94 0.11
95 0.1
96 0.09
97 0.1
98 0.09
99 0.11
100 0.12
101 0.13
102 0.15
103 0.19
104 0.24
105 0.24
106 0.26
107 0.25
108 0.26
109 0.25
110 0.26
111 0.24
112 0.18
113 0.18
114 0.17
115 0.17
116 0.16
117 0.14
118 0.1
119 0.11
120 0.12
121 0.12
122 0.11
123 0.12
124 0.12
125 0.14
126 0.14
127 0.15
128 0.15
129 0.17
130 0.2
131 0.21
132 0.22
133 0.21
134 0.22
135 0.22
136 0.23
137 0.22
138 0.19
139 0.18
140 0.16
141 0.21
142 0.2
143 0.19
144 0.19
145 0.18
146 0.17
147 0.16
148 0.15
149 0.09
150 0.08
151 0.08
152 0.07
153 0.08
154 0.07
155 0.08
156 0.08
157 0.1
158 0.1
159 0.13
160 0.16
161 0.15
162 0.17
163 0.19
164 0.2
165 0.19
166 0.2
167 0.21
168 0.19
169 0.2
170 0.18
171 0.17
172 0.15
173 0.14
174 0.16
175 0.14
176 0.12
177 0.1
178 0.1
179 0.1
180 0.1
181 0.11
182 0.08
183 0.09
184 0.11
185 0.12
186 0.15
187 0.18
188 0.17
189 0.19
190 0.2
191 0.19
192 0.19
193 0.21
194 0.27
195 0.27
196 0.31
197 0.31
198 0.31
199 0.3
200 0.29
201 0.28
202 0.2
203 0.18
204 0.16
205 0.17
206 0.15
207 0.15
208 0.15
209 0.12
210 0.11
211 0.09
212 0.08
213 0.06
214 0.06
215 0.06
216 0.07
217 0.07
218 0.08
219 0.09
220 0.09
221 0.08
222 0.08
223 0.12
224 0.14
225 0.2
226 0.2
227 0.21
228 0.2
229 0.2
230 0.2
231 0.19
232 0.21
233 0.21
234 0.27
235 0.27
236 0.27
237 0.28
238 0.29
239 0.29
240 0.3
241 0.3
242 0.26
243 0.28
244 0.29
245 0.28
246 0.29
247 0.29
248 0.23
249 0.17
250 0.14
251 0.11
252 0.09
253 0.08
254 0.06
255 0.04
256 0.04
257 0.04
258 0.04
259 0.03
260 0.04
261 0.05
262 0.06
263 0.06
264 0.07
265 0.07
266 0.11
267 0.14
268 0.18
269 0.18
270 0.2
271 0.21
272 0.21
273 0.21
274 0.17
275 0.14
276 0.1
277 0.08
278 0.06
279 0.05
280 0.04
281 0.04
282 0.04
283 0.04
284 0.06
285 0.06
286 0.07
287 0.09
288 0.09
289 0.15
290 0.19
291 0.2
292 0.21
293 0.25
294 0.26
295 0.26
296 0.26
297 0.21
298 0.22
299 0.22
300 0.24
301 0.2
302 0.18
303 0.17
304 0.16
305 0.16
306 0.11
307 0.11
308 0.08
309 0.09
310 0.11
311 0.12
312 0.12
313 0.12
314 0.12
315 0.13
316 0.15
317 0.16
318 0.19
319 0.23
320 0.27
321 0.3
322 0.33
323 0.33
324 0.32
325 0.28
326 0.28
327 0.25
328 0.23
329 0.21
330 0.22
331 0.23
332 0.23
333 0.23
334 0.19
335 0.18
336 0.14
337 0.17
338 0.16
339 0.14
340 0.12
341 0.12
342 0.14
343 0.15
344 0.15
345 0.12
346 0.13
347 0.16
348 0.22
349 0.25
350 0.25
351 0.26
352 0.3
353 0.31
354 0.34
355 0.35
356 0.35
357 0.34
358 0.37
359 0.41
360 0.4
361 0.42
362 0.43
363 0.47
364 0.48
365 0.52
366 0.56
367 0.54
368 0.53
369 0.55
370 0.56
371 0.56
372 0.52
373 0.49
374 0.46
375 0.45
376 0.44
377 0.47
378 0.41
379 0.35
380 0.34
381 0.3
382 0.32
383 0.31
384 0.3
385 0.24
386 0.24
387 0.23
388 0.24
389 0.25
390 0.21
391 0.21
392 0.24
393 0.28
394 0.31
395 0.33
396 0.36
397 0.42
398 0.41
399 0.43
400 0.42
401 0.41
402 0.39
403 0.43
404 0.39
405 0.4
406 0.47
407 0.49
408 0.48
409 0.5
410 0.48
411 0.43
412 0.41
413 0.33
414 0.26
415 0.23
416 0.19
417 0.13
418 0.1
419 0.1
420 0.09
421 0.08
422 0.08
423 0.07
424 0.07
425 0.08
426 0.09
427 0.08
428 0.1
429 0.17
430 0.18
431 0.25
432 0.33
433 0.38
434 0.46
435 0.5
436 0.54