Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A067TN31

Protein Details
Accession A0A067TN31    Localization Confidence Medium Confidence Score 14.3
NoLS Segment(s)
PositionSequenceProtein Nature
80-122PLDLRPKKTRAIRRRLTKHEASLKTLKQTKKDKNFPIRKYAVKHydrophilic
NLS Segment(s)
PositionSequence
84-118RPKKTRAIRRRLTKHEASLKTLKQTKKDKNFPIRK
Subcellular Location(s) nucl 24, cyto_nucl 14
Family & Domain DBs
InterPro View protein in InterPro  
IPR001854  Ribosomal_L29/L35  
IPR036049  Ribosomal_L29/L35_sf  
IPR018254  Ribosomal_L29_CS  
IPR045059  RL35  
Gene Ontology GO:0022625  C:cytosolic large ribosomal subunit  
GO:0003735  F:structural constituent of ribosome  
GO:0000463  P:maturation of LSU-rRNA from tricistronic rRNA transcript (SSU-rRNA, 5.8S rRNA, LSU-rRNA)  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF00831  Ribosomal_L29  
PROSITE View protein in PROSITE  
PS00579  RIBOSOMAL_L29  
CDD cd00427  Ribosomal_L29_HIP  
Amino Acid Sequences MAKVKAYELQSKSKNDLSKQLNELKNELLTLRVQKIAGGSASKLTKISAVRKSIARVLTVMNQKARQNLREYYKDKKYIPLDLRPKKTRAIRRRLTKHEASLKTLKQTKKDKNFPIRKYAVKA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.54
2 0.49
3 0.54
4 0.51
5 0.51
6 0.53
7 0.58
8 0.56
9 0.53
10 0.52
11 0.44
12 0.39
13 0.32
14 0.26
15 0.18
16 0.16
17 0.18
18 0.18
19 0.17
20 0.17
21 0.17
22 0.17
23 0.16
24 0.15
25 0.12
26 0.11
27 0.13
28 0.14
29 0.14
30 0.13
31 0.12
32 0.14
33 0.17
34 0.24
35 0.25
36 0.28
37 0.3
38 0.31
39 0.33
40 0.34
41 0.31
42 0.25
43 0.2
44 0.18
45 0.22
46 0.24
47 0.24
48 0.22
49 0.24
50 0.24
51 0.3
52 0.31
53 0.28
54 0.28
55 0.31
56 0.35
57 0.4
58 0.42
59 0.44
60 0.49
61 0.52
62 0.49
63 0.51
64 0.48
65 0.48
66 0.5
67 0.52
68 0.56
69 0.59
70 0.67
71 0.64
72 0.64
73 0.62
74 0.66
75 0.67
76 0.67
77 0.69
78 0.7
79 0.76
80 0.83
81 0.85
82 0.84
83 0.8
84 0.78
85 0.78
86 0.71
87 0.67
88 0.65
89 0.6
90 0.6
91 0.61
92 0.57
93 0.56
94 0.63
95 0.67
96 0.7
97 0.77
98 0.79
99 0.83
100 0.89
101 0.85
102 0.85
103 0.82