Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A067SJT2

Protein Details
Accession A0A067SJT2    Localization Confidence High Confidence Score 19.2
NoLS Segment(s)
PositionSequenceProtein Nature
276-312ATSSLGKRKIPPKKLPKKRPDKKPKKGPRVEVEYEQEBasic
NLS Segment(s)
PositionSequence
123-150RRLKLRQQPKLIGVKKKLDRREAVRERK
281-304GKRKIPPKKLPKKRPDKKPKKGPR
Subcellular Location(s) nucl 24, cyto 2
Family & Domain DBs
InterPro View protein in InterPro  
IPR029004  L28e/Mak16  
IPR006958  Mak16  
Gene Ontology GO:0005730  C:nucleolus  
Pfam View protein in Pfam  
PF04874  Mak16  
PF01778  Ribosomal_L28e  
Amino Acid Sequences MQSDDVIWSVINHQFCSYKVKTTTQNFCRNEYNVTGLCNRQSCPLANSRYATVREKEGVLYLYVKTIERAHSPAHMWERIKLSNSYAKALEQIDAELIHWPNFTIHKCKQRVTKITQYLIKMRRLKLRQQPKLIGVKKKLDRREAVRERKALSAAHLERSIEKELIERLKSKAYGDAPLNVNENVWQAILDRERNGGDTEKAAADLELEDDETDEEELEDEMEDEWGEREFVSDVSGDEDEDSLSDLEGVEDDGSEEDSDSEADDQEDSEPEETPATSSLGKRKIPPKKLPKKRPDKKPKKGPRVEVEYEQEMESVPISKSALANW
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.2
2 0.22
3 0.3
4 0.28
5 0.32
6 0.34
7 0.4
8 0.47
9 0.54
10 0.64
11 0.65
12 0.73
13 0.68
14 0.68
15 0.68
16 0.61
17 0.56
18 0.48
19 0.45
20 0.36
21 0.37
22 0.35
23 0.32
24 0.35
25 0.33
26 0.31
27 0.29
28 0.31
29 0.3
30 0.31
31 0.37
32 0.37
33 0.39
34 0.4
35 0.39
36 0.41
37 0.43
38 0.43
39 0.37
40 0.36
41 0.34
42 0.33
43 0.31
44 0.27
45 0.24
46 0.2
47 0.19
48 0.15
49 0.15
50 0.15
51 0.15
52 0.14
53 0.16
54 0.17
55 0.18
56 0.21
57 0.2
58 0.22
59 0.24
60 0.28
61 0.31
62 0.34
63 0.32
64 0.34
65 0.37
66 0.37
67 0.38
68 0.33
69 0.31
70 0.33
71 0.33
72 0.31
73 0.27
74 0.25
75 0.25
76 0.25
77 0.22
78 0.15
79 0.14
80 0.12
81 0.11
82 0.11
83 0.12
84 0.11
85 0.11
86 0.1
87 0.1
88 0.11
89 0.15
90 0.17
91 0.21
92 0.27
93 0.36
94 0.4
95 0.45
96 0.52
97 0.57
98 0.63
99 0.63
100 0.66
101 0.64
102 0.66
103 0.65
104 0.6
105 0.59
106 0.56
107 0.57
108 0.53
109 0.5
110 0.53
111 0.53
112 0.59
113 0.6
114 0.66
115 0.66
116 0.67
117 0.67
118 0.64
119 0.7
120 0.67
121 0.65
122 0.59
123 0.6
124 0.59
125 0.63
126 0.62
127 0.58
128 0.57
129 0.56
130 0.62
131 0.63
132 0.67
133 0.65
134 0.63
135 0.58
136 0.55
137 0.5
138 0.39
139 0.31
140 0.3
141 0.25
142 0.24
143 0.23
144 0.21
145 0.2
146 0.23
147 0.22
148 0.14
149 0.13
150 0.11
151 0.14
152 0.17
153 0.17
154 0.16
155 0.16
156 0.18
157 0.19
158 0.18
159 0.2
160 0.18
161 0.2
162 0.2
163 0.23
164 0.22
165 0.23
166 0.24
167 0.19
168 0.18
169 0.15
170 0.14
171 0.1
172 0.08
173 0.07
174 0.06
175 0.08
176 0.11
177 0.11
178 0.11
179 0.12
180 0.13
181 0.14
182 0.15
183 0.14
184 0.12
185 0.11
186 0.12
187 0.11
188 0.11
189 0.1
190 0.08
191 0.07
192 0.06
193 0.06
194 0.05
195 0.05
196 0.05
197 0.05
198 0.05
199 0.05
200 0.05
201 0.04
202 0.04
203 0.04
204 0.05
205 0.05
206 0.04
207 0.04
208 0.04
209 0.05
210 0.04
211 0.04
212 0.05
213 0.05
214 0.05
215 0.05
216 0.05
217 0.06
218 0.06
219 0.07
220 0.06
221 0.06
222 0.09
223 0.09
224 0.08
225 0.08
226 0.08
227 0.07
228 0.07
229 0.08
230 0.06
231 0.05
232 0.05
233 0.05
234 0.05
235 0.05
236 0.06
237 0.04
238 0.04
239 0.05
240 0.05
241 0.06
242 0.06
243 0.06
244 0.06
245 0.06
246 0.06
247 0.07
248 0.07
249 0.07
250 0.07
251 0.07
252 0.07
253 0.08
254 0.09
255 0.09
256 0.1
257 0.1
258 0.1
259 0.11
260 0.1
261 0.1
262 0.11
263 0.11
264 0.13
265 0.16
266 0.23
267 0.3
268 0.33
269 0.39
270 0.48
271 0.57
272 0.64
273 0.71
274 0.75
275 0.79
276 0.88
277 0.91
278 0.93
279 0.94
280 0.94
281 0.95
282 0.95
283 0.95
284 0.95
285 0.95
286 0.96
287 0.95
288 0.95
289 0.94
290 0.92
291 0.9
292 0.85
293 0.81
294 0.76
295 0.68
296 0.6
297 0.5
298 0.4
299 0.31
300 0.25
301 0.19
302 0.15
303 0.11
304 0.11
305 0.12
306 0.14