Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A067TSD4

Protein Details
Accession A0A067TSD4    Localization Confidence Low Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
1-25MPFPKSLKVHLHPRRARPPNFNLRLHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 23.5, cyto_mito 12.5
Family & Domain DBs
Amino Acid Sequences MPFPKSLKVHLHPRRARPPNFNLRLSVLIQGCHTYGSRPTSVAHVPPLVQTSHLPSLHNLIHRFVGVLGLDHRVVPGHLFPKFGEHPHLRSRRLAASHKRVPSSLGGQ
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.81
2 0.82
3 0.81
4 0.79
5 0.8
6 0.8
7 0.79
8 0.71
9 0.63
10 0.56
11 0.52
12 0.44
13 0.4
14 0.29
15 0.23
16 0.22
17 0.2
18 0.17
19 0.15
20 0.14
21 0.1
22 0.13
23 0.16
24 0.16
25 0.16
26 0.16
27 0.19
28 0.2
29 0.2
30 0.18
31 0.15
32 0.15
33 0.15
34 0.16
35 0.12
36 0.11
37 0.1
38 0.13
39 0.17
40 0.17
41 0.16
42 0.15
43 0.19
44 0.2
45 0.23
46 0.2
47 0.17
48 0.17
49 0.16
50 0.16
51 0.12
52 0.11
53 0.07
54 0.07
55 0.07
56 0.08
57 0.09
58 0.08
59 0.08
60 0.07
61 0.07
62 0.08
63 0.1
64 0.13
65 0.13
66 0.15
67 0.15
68 0.21
69 0.24
70 0.24
71 0.29
72 0.29
73 0.34
74 0.43
75 0.5
76 0.46
77 0.48
78 0.51
79 0.5
80 0.52
81 0.57
82 0.58
83 0.6
84 0.66
85 0.68
86 0.67
87 0.6
88 0.56