Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A067TJJ0

Protein Details
Accession A0A067TJJ0    Localization Confidence Medium Confidence Score 14.7
NoLS Segment(s)
PositionSequenceProtein Nature
1-27MAKSKNHTNHNQNKKAHRNGIRKPKSTHydrophilic
NLS Segment(s)
PositionSequence
14-45KKAHRNGIRKPKSTRTRSLKGVDAKFRRNARF
Subcellular Location(s) nucl 18, mito 6, cyto 3
Family & Domain DBs
InterPro View protein in InterPro  
IPR002673  Ribosomal_L29e  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF01779  Ribosomal_L29e  
Amino Acid Sequences MAKSKNHTNHNQNKKAHRNGIRKPKSTRTRSLKGVDAKFRRNARFALAGSNKARLEAKSS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.84
2 0.83
3 0.81
4 0.81
5 0.8
6 0.8
7 0.84
8 0.83
9 0.8
10 0.77
11 0.78
12 0.78
13 0.75
14 0.75
15 0.73
16 0.69
17 0.68
18 0.65
19 0.61
20 0.59
21 0.58
22 0.57
23 0.54
24 0.53
25 0.55
26 0.58
27 0.55
28 0.5
29 0.45
30 0.41
31 0.41
32 0.37
33 0.39
34 0.36
35 0.4
36 0.39
37 0.44
38 0.39
39 0.36
40 0.37