Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

B6QGE5

Protein Details
Accession B6QGE5    Localization Confidence Medium Confidence Score 14.3
NoLS Segment(s)
PositionSequenceProtein Nature
185-216VRTAGRAERKERIKRNERKMRANERRSRKFGABasic
NLS Segment(s)
PositionSequence
100-139KPLPKPKEPTRWELFARKKGIGKYSSKPGAAFAEKERRKK
188-216AGRAERKERIKRNERKMRANERRSRKFGA
Subcellular Location(s) nucl 16, cyto_nucl 13, cyto 8
Family & Domain DBs
InterPro View protein in InterPro  
IPR007023  Ribosom_reg  
Gene Ontology GO:0005634  C:nucleus  
GO:0042254  P:ribosome biogenesis  
KEGG tmf:PMAA_085270  -  
Pfam View protein in Pfam  
PF04939  RRS1  
Amino Acid Sequences MATTTEMMEVDAKPKNTKLPIVVQKENPYTFDLGHLLAQDPNPLVIPKSDNVNDSLKTVARDGAQVLLNQLLTTCPVTSNAKDGVLLTLPPPNTLLPRFKPLPKPKEPTRWELFARKKGIGKYSSKPGAAFAEKERRKKLVYDEASGEWVPRWGFKGANKSGENDWAVEVPDKDWKQEAEGKMNVRTAGRAERKERIKRNERKMRANERRSRKFGA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.26
2 0.32
3 0.33
4 0.37
5 0.37
6 0.42
7 0.5
8 0.55
9 0.59
10 0.58
11 0.61
12 0.64
13 0.6
14 0.52
15 0.45
16 0.38
17 0.32
18 0.29
19 0.22
20 0.17
21 0.17
22 0.15
23 0.14
24 0.14
25 0.14
26 0.14
27 0.12
28 0.12
29 0.12
30 0.11
31 0.11
32 0.11
33 0.14
34 0.13
35 0.19
36 0.2
37 0.2
38 0.23
39 0.26
40 0.24
41 0.23
42 0.23
43 0.19
44 0.18
45 0.18
46 0.17
47 0.14
48 0.14
49 0.14
50 0.15
51 0.15
52 0.14
53 0.14
54 0.12
55 0.12
56 0.11
57 0.1
58 0.07
59 0.07
60 0.07
61 0.07
62 0.06
63 0.09
64 0.12
65 0.13
66 0.16
67 0.16
68 0.15
69 0.15
70 0.15
71 0.13
72 0.11
73 0.1
74 0.08
75 0.1
76 0.1
77 0.1
78 0.11
79 0.1
80 0.12
81 0.14
82 0.19
83 0.18
84 0.23
85 0.26
86 0.3
87 0.39
88 0.46
89 0.52
90 0.55
91 0.6
92 0.62
93 0.69
94 0.68
95 0.65
96 0.6
97 0.56
98 0.51
99 0.53
100 0.52
101 0.49
102 0.49
103 0.44
104 0.44
105 0.41
106 0.44
107 0.4
108 0.39
109 0.36
110 0.41
111 0.42
112 0.39
113 0.36
114 0.33
115 0.31
116 0.28
117 0.26
118 0.23
119 0.3
120 0.34
121 0.4
122 0.41
123 0.4
124 0.4
125 0.41
126 0.43
127 0.43
128 0.42
129 0.4
130 0.4
131 0.38
132 0.39
133 0.36
134 0.29
135 0.18
136 0.16
137 0.13
138 0.11
139 0.13
140 0.12
141 0.14
142 0.18
143 0.28
144 0.3
145 0.38
146 0.38
147 0.38
148 0.38
149 0.41
150 0.37
151 0.28
152 0.25
153 0.18
154 0.18
155 0.18
156 0.17
157 0.12
158 0.2
159 0.2
160 0.2
161 0.22
162 0.21
163 0.24
164 0.31
165 0.33
166 0.32
167 0.37
168 0.38
169 0.39
170 0.41
171 0.38
172 0.31
173 0.29
174 0.25
175 0.31
176 0.36
177 0.4
178 0.43
179 0.5
180 0.6
181 0.68
182 0.75
183 0.75
184 0.78
185 0.81
186 0.87
187 0.9
188 0.88
189 0.89
190 0.9
191 0.9
192 0.91
193 0.91
194 0.9
195 0.9
196 0.91