Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A067SR84

Protein Details
Accession A0A067SR84   
Localization Confidence Low
Confidence Score 7.5
NoLS Segment(s)
PositionSequenceProtein Nature
40-65ATPVPRVGHRQPRRRRLEQQQQCNRDHydrophilic
NLS Segment(s)
Subcellular Location(s) cyto 11.5, cyto_nucl 10.5, nucl 8.5, mito 4
Family & Domain DBs
InterPro View protein in InterPro  
IPR004203  Cyt_c_oxidase_su4_fam  
IPR036639  Cyt_c_oxidase_su4_sf  
Gene Ontology GO:0005751  C:mitochondrial respiratory chain complex IV  
GO:0006123  P:mitochondrial electron transport, cytochrome c to oxygen  
Pfam View protein in Pfam  
PF02936  COX4  
Amino Acid Sequences MVGDEDKEIEYNSRLSRAVILPASVGPPCSLPTAAALRAATPVPRVGHRQPRRRRLEQQQQCNRDGDGGVDHPAGPDPAVDIEAQWVKMSAEEVSVHEQLEVLQQKDWKELSLDEKKAAHYVAFGPHVPLCGASTEDLTKEWQEASNERALEMKLNPITGISSEGYKGKGFVQ
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.2
2 0.2
3 0.24
4 0.23
5 0.26
6 0.22
7 0.21
8 0.19
9 0.19
10 0.2
11 0.16
12 0.15
13 0.1
14 0.1
15 0.11
16 0.13
17 0.12
18 0.11
19 0.14
20 0.17
21 0.17
22 0.18
23 0.17
24 0.15
25 0.17
26 0.17
27 0.14
28 0.12
29 0.15
30 0.14
31 0.17
32 0.23
33 0.29
34 0.4
35 0.48
36 0.58
37 0.64
38 0.73
39 0.8
40 0.81
41 0.83
42 0.82
43 0.84
44 0.83
45 0.84
46 0.84
47 0.8
48 0.74
49 0.66
50 0.55
51 0.45
52 0.35
53 0.25
54 0.16
55 0.12
56 0.11
57 0.1
58 0.1
59 0.09
60 0.09
61 0.08
62 0.06
63 0.05
64 0.04
65 0.04
66 0.05
67 0.05
68 0.04
69 0.06
70 0.07
71 0.07
72 0.07
73 0.07
74 0.06
75 0.06
76 0.07
77 0.05
78 0.05
79 0.06
80 0.07
81 0.11
82 0.11
83 0.11
84 0.1
85 0.1
86 0.09
87 0.14
88 0.15
89 0.12
90 0.13
91 0.16
92 0.16
93 0.19
94 0.19
95 0.14
96 0.13
97 0.14
98 0.21
99 0.27
100 0.28
101 0.27
102 0.28
103 0.29
104 0.29
105 0.27
106 0.19
107 0.13
108 0.13
109 0.14
110 0.15
111 0.15
112 0.15
113 0.15
114 0.16
115 0.15
116 0.13
117 0.1
118 0.09
119 0.1
120 0.09
121 0.1
122 0.1
123 0.11
124 0.11
125 0.13
126 0.12
127 0.12
128 0.13
129 0.14
130 0.17
131 0.18
132 0.21
133 0.24
134 0.24
135 0.23
136 0.24
137 0.22
138 0.22
139 0.21
140 0.24
141 0.21
142 0.21
143 0.21
144 0.19
145 0.19
146 0.16
147 0.19
148 0.12
149 0.12
150 0.14
151 0.16
152 0.18
153 0.17