Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A067SB19

Protein Details
Accession A0A067SB19    Localization Confidence Medium Confidence Score 10.9
NoLS Segment(s)
PositionSequenceProtein Nature
26-51CPAVSISCSRRRRRHRRSTPPCFFVRHydrophilic
NLS Segment(s)
PositionSequence
36-42RRRRHRR
Subcellular Location(s) mito 14, nucl 9.5, cyto_nucl 6.5, cyto 2.5
Family & Domain DBs
Amino Acid Sequences MSAQIALSTSPPPALALARSRSTVCCPAVSISCSRRRRRHRRSTPPCFFVRMLKASAAAAGGHGLRAVRSK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.11
2 0.12
3 0.16
4 0.2
5 0.21
6 0.23
7 0.24
8 0.24
9 0.27
10 0.3
11 0.26
12 0.22
13 0.21
14 0.21
15 0.22
16 0.22
17 0.22
18 0.22
19 0.3
20 0.38
21 0.45
22 0.53
23 0.62
24 0.72
25 0.78
26 0.84
27 0.86
28 0.9
29 0.93
30 0.94
31 0.92
32 0.86
33 0.77
34 0.7
35 0.6
36 0.54
37 0.49
38 0.41
39 0.34
40 0.29
41 0.28
42 0.23
43 0.23
44 0.17
45 0.11
46 0.08
47 0.08
48 0.08
49 0.07
50 0.08
51 0.07