Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A067S725

Protein Details
Accession A0A067S725   
Localization Confidence High
Confidence Score 16.5
NoLS Segment(s)
PositionSequenceProtein Nature
110-133LEEQDKARKDKRARQKEKRKLGPNBasic
NLS Segment(s)
PositionSequence
115-133KARKDKRARQKEKRKLGPN
Subcellular Location(s) nucl 23, cyto 4
Family & Domain DBs
InterPro View protein in InterPro  
IPR001214  SET_dom  
IPR046341  SET_dom_sf  
Pfam View protein in Pfam  
PF00856  SET  
Amino Acid Sequences MYTDLSMITPHHDNRNDDKNPSFEEKLLIGPIRFINHRCVSYNVEFIAIRDTYAFTVVATKNIKAKEEILLCYGVNYFKEKGSECLCEDCREIPDEEEKASKKHEGQINLEEQDKARKDKRARQKEKRKLGPN
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.44
2 0.53
3 0.53
4 0.52
5 0.52
6 0.47
7 0.47
8 0.49
9 0.44
10 0.34
11 0.33
12 0.3
13 0.28
14 0.28
15 0.24
16 0.17
17 0.17
18 0.18
19 0.19
20 0.2
21 0.2
22 0.25
23 0.27
24 0.29
25 0.29
26 0.31
27 0.34
28 0.34
29 0.35
30 0.27
31 0.25
32 0.23
33 0.21
34 0.21
35 0.14
36 0.12
37 0.1
38 0.1
39 0.08
40 0.09
41 0.09
42 0.05
43 0.1
44 0.1
45 0.14
46 0.15
47 0.15
48 0.19
49 0.19
50 0.2
51 0.17
52 0.17
53 0.18
54 0.18
55 0.18
56 0.16
57 0.16
58 0.15
59 0.14
60 0.14
61 0.1
62 0.09
63 0.11
64 0.1
65 0.1
66 0.13
67 0.13
68 0.16
69 0.18
70 0.21
71 0.2
72 0.25
73 0.25
74 0.25
75 0.26
76 0.24
77 0.22
78 0.21
79 0.21
80 0.17
81 0.2
82 0.19
83 0.19
84 0.23
85 0.23
86 0.22
87 0.24
88 0.26
89 0.24
90 0.3
91 0.35
92 0.35
93 0.39
94 0.44
95 0.46
96 0.44
97 0.43
98 0.37
99 0.32
100 0.36
101 0.34
102 0.35
103 0.35
104 0.42
105 0.5
106 0.59
107 0.69
108 0.72
109 0.8
110 0.84
111 0.9
112 0.92
113 0.94