Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A067TTZ4

Protein Details
Accession A0A067TTZ4    Localization Confidence Low Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
157-185DKEPAGSKRQEKLRKRQEKGDPRVRVQTGBasic
NLS Segment(s)
PositionSequence
162-187GSKRQEKLRKRQEKGDPRVRVQTGRK
Subcellular Location(s) mito 12, plas 6, mito_nucl 6, extr 5
Family & Domain DBs
InterPro View protein in InterPro  
IPR008506  SND2/TMEM208  
Gene Ontology GO:0005789  C:endoplasmic reticulum membrane  
Pfam View protein in Pfam  
PF05620  TMEM208_SND2  
Amino Acid Sequences MGNASGKRIANQNENTVKTLRLGMILPTILSLVLRFLFRRGSLPPSKGSLAIYIVTFFPAFFLSNYLIKQGSPRRDPTTGTLISSGEDLSQPGVTEWCFDILYITWACQIGSGTFGEWFWWLYMVIPLYAVFKLWTSVISPMVLGGGLSGPSDSTPDKEPAGSKRQEKLRKRQEKGDPRVRVQTGRK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.53
2 0.53
3 0.48
4 0.43
5 0.35
6 0.34
7 0.25
8 0.19
9 0.17
10 0.15
11 0.17
12 0.16
13 0.14
14 0.12
15 0.11
16 0.09
17 0.09
18 0.07
19 0.06
20 0.07
21 0.08
22 0.09
23 0.1
24 0.13
25 0.14
26 0.16
27 0.17
28 0.24
29 0.29
30 0.32
31 0.33
32 0.34
33 0.34
34 0.33
35 0.31
36 0.24
37 0.2
38 0.18
39 0.15
40 0.12
41 0.11
42 0.11
43 0.1
44 0.08
45 0.07
46 0.07
47 0.07
48 0.07
49 0.09
50 0.1
51 0.12
52 0.12
53 0.13
54 0.12
55 0.12
56 0.18
57 0.22
58 0.27
59 0.3
60 0.34
61 0.38
62 0.39
63 0.41
64 0.38
65 0.39
66 0.32
67 0.29
68 0.25
69 0.2
70 0.19
71 0.17
72 0.14
73 0.07
74 0.06
75 0.06
76 0.05
77 0.05
78 0.05
79 0.05
80 0.05
81 0.05
82 0.06
83 0.06
84 0.06
85 0.06
86 0.06
87 0.06
88 0.06
89 0.09
90 0.08
91 0.08
92 0.07
93 0.08
94 0.08
95 0.07
96 0.08
97 0.05
98 0.07
99 0.07
100 0.06
101 0.06
102 0.06
103 0.07
104 0.06
105 0.07
106 0.06
107 0.06
108 0.06
109 0.06
110 0.08
111 0.08
112 0.07
113 0.07
114 0.07
115 0.08
116 0.08
117 0.08
118 0.06
119 0.06
120 0.07
121 0.07
122 0.07
123 0.07
124 0.09
125 0.1
126 0.1
127 0.09
128 0.08
129 0.08
130 0.08
131 0.06
132 0.04
133 0.04
134 0.04
135 0.04
136 0.04
137 0.04
138 0.04
139 0.07
140 0.08
141 0.1
142 0.13
143 0.16
144 0.17
145 0.19
146 0.23
147 0.27
148 0.35
149 0.4
150 0.42
151 0.48
152 0.57
153 0.65
154 0.71
155 0.75
156 0.78
157 0.82
158 0.83
159 0.84
160 0.86
161 0.86
162 0.88
163 0.87
164 0.84
165 0.79
166 0.82
167 0.76