Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A067TTQ1

Protein Details
Accession A0A067TTQ1    Localization Confidence High Confidence Score 16.4
NoLS Segment(s)
PositionSequenceProtein Nature
39-68SPASSFSSSPRKRQRRDSPKKPPKDVDLEQHydrophilic
NLS Segment(s)
PositionSequence
48-61PRKRQRRDSPKKPP
113-120KRRGSKKH
Subcellular Location(s) nucl 24.5, cyto_nucl 13.5
Family & Domain DBs
Amino Acid Sequences MPLTRHFSSSPSKLPHSSDTELYETPLRKRFRNFEEDDSPASSFSSSPRKRQRRDSPKKPPKDVDLEQVLRDIIADPTNHNAVVELKTVPRDERTARRLVNRLLHSTKAAVMKRRGSKKHKLLETELYLEWLNELDYVASALDVALNAKVPGTRRRITGLGRVCYTILYNLVDEFIDEVNAHHDGPSTKSSEPCLYPATMTLVEEAKDPSTDDRSDKAVQLAEEALRGIDKVLADAVRRHKAECGRNNPSLAIKISAQEHALAKGCCLLCEQTGYGTVESDIGDTLMDEARGVLMQWKSEYEDCEDQLDDSD
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.52
2 0.54
3 0.53
4 0.5
5 0.46
6 0.44
7 0.43
8 0.4
9 0.38
10 0.37
11 0.33
12 0.35
13 0.4
14 0.39
15 0.41
16 0.48
17 0.55
18 0.57
19 0.63
20 0.63
21 0.64
22 0.66
23 0.64
24 0.59
25 0.52
26 0.45
27 0.35
28 0.3
29 0.22
30 0.16
31 0.17
32 0.25
33 0.27
34 0.36
35 0.47
36 0.57
37 0.64
38 0.74
39 0.81
40 0.82
41 0.89
42 0.9
43 0.91
44 0.91
45 0.94
46 0.92
47 0.86
48 0.82
49 0.8
50 0.72
51 0.68
52 0.67
53 0.59
54 0.51
55 0.46
56 0.38
57 0.28
58 0.25
59 0.18
60 0.1
61 0.1
62 0.11
63 0.11
64 0.14
65 0.15
66 0.15
67 0.14
68 0.13
69 0.13
70 0.14
71 0.15
72 0.12
73 0.13
74 0.15
75 0.16
76 0.17
77 0.17
78 0.19
79 0.23
80 0.31
81 0.35
82 0.4
83 0.42
84 0.47
85 0.5
86 0.51
87 0.54
88 0.48
89 0.51
90 0.46
91 0.44
92 0.39
93 0.34
94 0.33
95 0.31
96 0.31
97 0.3
98 0.33
99 0.39
100 0.46
101 0.54
102 0.59
103 0.6
104 0.68
105 0.71
106 0.74
107 0.72
108 0.69
109 0.64
110 0.62
111 0.57
112 0.5
113 0.4
114 0.33
115 0.28
116 0.23
117 0.18
118 0.11
119 0.09
120 0.05
121 0.05
122 0.03
123 0.03
124 0.04
125 0.03
126 0.03
127 0.03
128 0.03
129 0.03
130 0.03
131 0.03
132 0.03
133 0.03
134 0.03
135 0.04
136 0.05
137 0.07
138 0.14
139 0.2
140 0.21
141 0.22
142 0.26
143 0.29
144 0.29
145 0.35
146 0.34
147 0.31
148 0.3
149 0.29
150 0.26
151 0.24
152 0.22
153 0.15
154 0.1
155 0.08
156 0.07
157 0.07
158 0.07
159 0.06
160 0.06
161 0.07
162 0.05
163 0.05
164 0.05
165 0.05
166 0.06
167 0.07
168 0.07
169 0.06
170 0.08
171 0.08
172 0.11
173 0.13
174 0.14
175 0.15
176 0.16
177 0.19
178 0.21
179 0.21
180 0.2
181 0.2
182 0.17
183 0.17
184 0.16
185 0.17
186 0.14
187 0.13
188 0.12
189 0.11
190 0.11
191 0.12
192 0.12
193 0.09
194 0.09
195 0.09
196 0.1
197 0.13
198 0.15
199 0.16
200 0.17
201 0.21
202 0.23
203 0.23
204 0.23
205 0.21
206 0.19
207 0.18
208 0.18
209 0.14
210 0.12
211 0.11
212 0.09
213 0.07
214 0.07
215 0.06
216 0.06
217 0.06
218 0.06
219 0.08
220 0.09
221 0.1
222 0.16
223 0.22
224 0.28
225 0.29
226 0.29
227 0.33
228 0.4
229 0.49
230 0.53
231 0.56
232 0.56
233 0.59
234 0.6
235 0.56
236 0.5
237 0.44
238 0.36
239 0.29
240 0.22
241 0.21
242 0.22
243 0.22
244 0.2
245 0.19
246 0.19
247 0.19
248 0.22
249 0.2
250 0.18
251 0.22
252 0.22
253 0.19
254 0.2
255 0.2
256 0.16
257 0.19
258 0.2
259 0.15
260 0.19
261 0.2
262 0.19
263 0.17
264 0.16
265 0.14
266 0.14
267 0.13
268 0.09
269 0.07
270 0.07
271 0.06
272 0.07
273 0.07
274 0.07
275 0.07
276 0.07
277 0.07
278 0.07
279 0.08
280 0.12
281 0.12
282 0.15
283 0.16
284 0.17
285 0.22
286 0.24
287 0.26
288 0.27
289 0.31
290 0.31
291 0.32
292 0.31