Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A067TCZ1

Protein Details
Accession A0A067TCZ1    Localization Confidence Low Confidence Score 9.2
NoLS Segment(s)
PositionSequenceProtein Nature
84-107ARPNTNPERHTPRKANPRPQKKKABasic
NLS Segment(s)
PositionSequence
92-107RHTPRKANPRPQKKKA
Subcellular Location(s) extr 17, mito 5, nucl 3
Family & Domain DBs
Amino Acid Sequences MRFLTLFLTAVTLAISVNAIPVAPLTDIAAARSESYTAETARLPNLQVRASSQKPKKPKGPYRTTTPTSKTGPQGQYLYKPTDARPNTNPERHTPRKANPRPQKKKA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.06
2 0.06
3 0.04
4 0.04
5 0.04
6 0.04
7 0.04
8 0.04
9 0.05
10 0.05
11 0.05
12 0.06
13 0.08
14 0.08
15 0.09
16 0.1
17 0.09
18 0.1
19 0.1
20 0.09
21 0.07
22 0.1
23 0.11
24 0.1
25 0.11
26 0.11
27 0.11
28 0.13
29 0.13
30 0.11
31 0.13
32 0.14
33 0.14
34 0.13
35 0.16
36 0.21
37 0.23
38 0.32
39 0.35
40 0.38
41 0.46
42 0.51
43 0.56
44 0.61
45 0.67
46 0.68
47 0.73
48 0.71
49 0.72
50 0.74
51 0.7
52 0.66
53 0.6
54 0.55
55 0.49
56 0.49
57 0.44
58 0.44
59 0.43
60 0.4
61 0.4
62 0.37
63 0.39
64 0.39
65 0.38
66 0.33
67 0.33
68 0.31
69 0.37
70 0.38
71 0.38
72 0.39
73 0.45
74 0.5
75 0.55
76 0.56
77 0.54
78 0.61
79 0.63
80 0.67
81 0.66
82 0.68
83 0.73
84 0.8
85 0.83
86 0.84
87 0.88