Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A067THG5

Protein Details
Accession A0A067THG5    Localization Confidence Low Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
57-81GPKVQNGKRIRSRRIKDKTSKQTTTHydrophilic
NLS Segment(s)
PositionSequence
49-74PKKVVRGWGPKVQNGKRIRSRRIKDK
Subcellular Location(s) mito 12, cyto 9, mito_nucl 9
Family & Domain DBs
InterPro View protein in InterPro  
IPR019083  IGR_protein_motif  
Pfam View protein in Pfam  
PF09597  IGR  
Amino Acid Sequences MAWEELWRLNGQALRKAGVAVRDRRYILWCMSKYRLGFSIGEFAHEPPPKKVVRGWGPKVQNGKRIRSRRIKDKTSKQTTT
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.24
2 0.24
3 0.24
4 0.22
5 0.27
6 0.31
7 0.32
8 0.35
9 0.37
10 0.38
11 0.38
12 0.4
13 0.36
14 0.33
15 0.34
16 0.31
17 0.32
18 0.34
19 0.36
20 0.34
21 0.32
22 0.3
23 0.23
24 0.22
25 0.18
26 0.21
27 0.17
28 0.18
29 0.17
30 0.16
31 0.21
32 0.23
33 0.24
34 0.19
35 0.24
36 0.23
37 0.24
38 0.25
39 0.28
40 0.35
41 0.44
42 0.48
43 0.51
44 0.54
45 0.58
46 0.66
47 0.61
48 0.59
49 0.55
50 0.59
51 0.61
52 0.66
53 0.71
54 0.72
55 0.77
56 0.79
57 0.84
58 0.85
59 0.85
60 0.88
61 0.89