Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A067T2X7

Protein Details
Accession A0A067T2X7    Localization Confidence Medium Confidence Score 14
NoLS Segment(s)
PositionSequenceProtein Nature
109-142SGGRCKNKFEPGPKPKKRQRKDRCADNVDRRGKSBasic
NLS Segment(s)
PositionSequence
114-129KNKFEPGPKPKKRQRK
Subcellular Location(s) nucl 18, mito 4, cyto 4, cyto_mito 4
Family & Domain DBs
Amino Acid Sequences MTQLERKTIGNAAFLDGKAWNGVIGLDFIGHTETEHISRGICQLHAVREIKEDKFIALCAQTERLPHRNTGKENCGGTPDRWPEDSYGVKVNFFSNSSQCGSSLRKSSSGGRCKNKFEPGPKPKKRQRKDRCADNVDRRGKSTQDMGYVHLMSSTNEIRPNLRSRFPPP
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.25
2 0.23
3 0.18
4 0.17
5 0.14
6 0.13
7 0.1
8 0.07
9 0.07
10 0.06
11 0.06
12 0.06
13 0.06
14 0.05
15 0.06
16 0.06
17 0.06
18 0.06
19 0.07
20 0.08
21 0.09
22 0.11
23 0.11
24 0.1
25 0.11
26 0.14
27 0.14
28 0.12
29 0.14
30 0.15
31 0.17
32 0.24
33 0.24
34 0.22
35 0.26
36 0.3
37 0.28
38 0.29
39 0.26
40 0.2
41 0.2
42 0.19
43 0.15
44 0.12
45 0.13
46 0.1
47 0.12
48 0.12
49 0.15
50 0.19
51 0.24
52 0.24
53 0.27
54 0.33
55 0.36
56 0.4
57 0.43
58 0.43
59 0.41
60 0.41
61 0.37
62 0.35
63 0.31
64 0.27
65 0.28
66 0.26
67 0.23
68 0.23
69 0.24
70 0.21
71 0.23
72 0.23
73 0.18
74 0.2
75 0.18
76 0.18
77 0.17
78 0.17
79 0.14
80 0.14
81 0.14
82 0.1
83 0.13
84 0.14
85 0.14
86 0.13
87 0.16
88 0.17
89 0.19
90 0.23
91 0.22
92 0.22
93 0.24
94 0.32
95 0.38
96 0.45
97 0.5
98 0.55
99 0.58
100 0.62
101 0.66
102 0.66
103 0.63
104 0.61
105 0.64
106 0.65
107 0.72
108 0.75
109 0.81
110 0.82
111 0.86
112 0.88
113 0.89
114 0.89
115 0.89
116 0.89
117 0.89
118 0.9
119 0.88
120 0.88
121 0.87
122 0.86
123 0.83
124 0.75
125 0.68
126 0.6
127 0.53
128 0.47
129 0.43
130 0.36
131 0.34
132 0.33
133 0.33
134 0.34
135 0.33
136 0.29
137 0.25
138 0.22
139 0.16
140 0.2
141 0.2
142 0.18
143 0.22
144 0.23
145 0.24
146 0.3
147 0.37
148 0.38
149 0.41