Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A067TN18

Protein Details
Accession A0A067TN18    Localization Confidence Low Confidence Score 8.3
NoLS Segment(s)
PositionSequenceProtein Nature
1-26MLWAQKRGYGRPERKKRSQNFNISSGHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 11.5, mito 9, cyto_nucl 9, cyto 5.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR029319  DNA_ligase_OB  
Pfam View protein in Pfam  
PF14743  DNA_ligase_OB_2  
Amino Acid Sequences MLWAQKRGYGRPERKKRSQNFNISSGFTDEINQSVPKLAAIIGYRFQDLTRDIVSRFPFVGIAIDIDEPKDAVIFERQKAEPGVDSEVI
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.82
2 0.88
3 0.88
4 0.88
5 0.88
6 0.88
7 0.81
8 0.78
9 0.71
10 0.62
11 0.54
12 0.45
13 0.36
14 0.25
15 0.21
16 0.15
17 0.13
18 0.13
19 0.11
20 0.09
21 0.09
22 0.09
23 0.08
24 0.07
25 0.07
26 0.07
27 0.08
28 0.09
29 0.1
30 0.11
31 0.11
32 0.11
33 0.11
34 0.1
35 0.1
36 0.12
37 0.11
38 0.12
39 0.12
40 0.16
41 0.18
42 0.17
43 0.17
44 0.15
45 0.13
46 0.12
47 0.13
48 0.09
49 0.08
50 0.08
51 0.08
52 0.08
53 0.08
54 0.08
55 0.07
56 0.07
57 0.06
58 0.05
59 0.06
60 0.15
61 0.18
62 0.2
63 0.27
64 0.27
65 0.3
66 0.31
67 0.31
68 0.26
69 0.25