FuNGI

A0A067TBF6

Protein Details

Accession

A0A067TBF6

Localization Confidence

High

Confidence Score

22.7

NoLS Segment(s)

Position	Sequence	Protein Nature
1-31	MSTAPAPPKAQKFKKEKEKERDKERKASIPG	Hydrophilic
67-90	VWKIYYQGKLRKKLNKENIPSRAY	Hydrophilic
125-147	FAPYPKVPSEKRKPDNRNATIEK	Hydrophilic
416-439	KPPAPLSQSPKKEKTRRGGRGGGG	Basic

NLS Segment(s)

Position	Sequence
8-29	PKAQKFKKEKEKERDKERKASI
295-311	ARPPRPPRAPRPPPPAK
425-437	PKKEKTRRGGRGG
508-532	RGGGRRGRGGGRGRGGGAPSAPRGG

Subcellular Location(s)

nucl 22.5, cyto_nucl 13.5, cyto 3.5

Family & Domain DBs

InterPro	View protein in InterPro IPR012677 Nucleotide-bd_a/b_plait_sf IPR035979 RBD_domain_sf IPR039722 Upf3 IPR005120 UPF3_dom
Gene Ontology	GO:0003676 F:nucleic acid binding GO:0000184 P:nuclear-transcribed mRNA catabolic process, nonsense-mediated decay
Pfam	View protein in Pfam PF03467 Smg4_UPF3
CDD	cd12455 RRM_like_Smg4_UPF3

Amino Acid Sequences

MSTAPAPPKAQKFKKEKEKERDKERKASIPGPLNERLKTVVRRLPPNLPEDIFWQSVQTWVTEETAVWKIYYQGKLRKKLNKENIPSRAYIAFKNEEQLALFSREYDGHVFRDKAGVESQAVVEFAPYPKVPSEKRKPDNRNATIEKDEDFISFVESLKAAENAEPVSLESLIAASQPPPPPKTTPLLEALKAEKSANRDKEAILRNHAHYNQLNGASSRKDEKKKASALPPSVSSKPSESATANASNAGGGRKIPKKPQGNASGTAGSVNPKNAAPSGQTPKGVPTNAPANQAARPPRPPRAPRPPPPAKQAANETRPNPPAIAVPPGGPQTDSPASPITPPPTRRSRPVLGLGSRQFEAALSGVAGLASAATERKRREKEKETQNAGGGAGPSTSAAPAPTFPFARIDGSDSEKPPAPLSQSPKKEKTRRGGRGGGGGHNATSSGETSQVKVPSILQRVDAPPPTAVLQKDLAEGSNAVAPEGPVAASFVPSANPPGNTNTGTPNRGGGRRGRGGGRGRGGGAPSAPRGG

FASTA Sequence
with NoLS information

AlphaFold Structure
with highlighted NoLS

NoLS Predictions per Residue

Residue Number	Score
1	0.85
2	0.89
3	0.9
4	0.9
5	0.93
6	0.92
7	0.93
8	0.94
9	0.9
10	0.89
11	0.86
12	0.83
13	0.79
14	0.75
15	0.72
16	0.7
17	0.67
18	0.64
19	0.65
20	0.6
21	0.54
22	0.51
23	0.46
24	0.44
25	0.44
26	0.46
27	0.45
28	0.48
29	0.55
30	0.58
31	0.63
32	0.61
33	0.59
34	0.57
35	0.51
36	0.45
37	0.41
38	0.41
39	0.33
40	0.28
41	0.26
42	0.2
43	0.22
44	0.21
45	0.18
46	0.14
47	0.14
48	0.15
49	0.14
50	0.14
51	0.15
52	0.18
53	0.18
54	0.16
55	0.15
56	0.18
57	0.25
58	0.32
59	0.35
60	0.41
61	0.49
62	0.59
63	0.67
64	0.72
65	0.75
66	0.79
67	0.83
68	0.83
69	0.84
70	0.85
71	0.85
72	0.79
73	0.7
74	0.62
75	0.56
76	0.48
77	0.41
78	0.37
79	0.32
80	0.29
81	0.32
82	0.29
83	0.25
84	0.23
85	0.22
86	0.19
87	0.19
88	0.18
89	0.15
90	0.16
91	0.16
92	0.17
93	0.2
94	0.19
95	0.18
96	0.23
97	0.24
98	0.23
99	0.26
100	0.24
101	0.22
102	0.22
103	0.2
104	0.16
105	0.17
106	0.17
107	0.13
108	0.13
109	0.11
110	0.09
111	0.09
112	0.09
113	0.11
114	0.1
115	0.11
116	0.14
117	0.2
118	0.24
119	0.33
120	0.44
121	0.52
122	0.6
123	0.69
124	0.76
125	0.81
126	0.87
127	0.82
128	0.81
129	0.75
130	0.71
131	0.64
132	0.57
133	0.47
134	0.38
135	0.32
136	0.23
137	0.19
138	0.14
139	0.12
140	0.11
141	0.1
142	0.09
143	0.09
144	0.09
145	0.09
146	0.1
147	0.08
148	0.09
149	0.09
150	0.09
151	0.09
152	0.09
153	0.08
154	0.08
155	0.08
156	0.07
157	0.05
158	0.05
159	0.05
160	0.05
161	0.05
162	0.05
163	0.1
164	0.14
165	0.18
166	0.2
167	0.23
168	0.26
169	0.29
170	0.33
171	0.3
172	0.29
173	0.33
174	0.34
175	0.32
176	0.31
177	0.3
178	0.26
179	0.25
180	0.23
181	0.18
182	0.2
183	0.28
184	0.29
185	0.3
186	0.3
187	0.3
188	0.37
189	0.43
190	0.4
191	0.37
192	0.37
193	0.36
194	0.4
195	0.4
196	0.37
197	0.3
198	0.31
199	0.29
200	0.26
201	0.24
202	0.19
203	0.21
204	0.17
205	0.18
206	0.21
207	0.25
208	0.3
209	0.34
210	0.4
211	0.46
212	0.51
213	0.56
214	0.57
215	0.57
216	0.55
217	0.51
218	0.48
219	0.45
220	0.4
221	0.35
222	0.29
223	0.24
224	0.21
225	0.2
226	0.19
227	0.15
228	0.15
229	0.17
230	0.18
231	0.16
232	0.14
233	0.13
234	0.11
235	0.11
236	0.1
237	0.07
238	0.06
239	0.12
240	0.17
241	0.2
242	0.26
243	0.34
244	0.41
245	0.44
246	0.51
247	0.55
248	0.53
249	0.51
250	0.48
251	0.4
252	0.33
253	0.3
254	0.22
255	0.14
256	0.12
257	0.1
258	0.09
259	0.08
260	0.09
261	0.09
262	0.09
263	0.1
264	0.15
265	0.21
266	0.22
267	0.22
268	0.22
269	0.24
270	0.27
271	0.25
272	0.19
273	0.16
274	0.21
275	0.22
276	0.25
277	0.23
278	0.21
279	0.23
280	0.27
281	0.29
282	0.25
283	0.3
284	0.32
285	0.38
286	0.46
287	0.5
288	0.55
289	0.62
290	0.68
291	0.7
292	0.76
293	0.79
294	0.74
295	0.74
296	0.73
297	0.64
298	0.58
299	0.57
300	0.55
301	0.52
302	0.53
303	0.48
304	0.46
305	0.45
306	0.42
307	0.34
308	0.26
309	0.22
310	0.19
311	0.2
312	0.15
313	0.14
314	0.16
315	0.17
316	0.16
317	0.14
318	0.13
319	0.15
320	0.16
321	0.15
322	0.15
323	0.15
324	0.16
325	0.17
326	0.19
327	0.18
328	0.23
329	0.26
330	0.3
331	0.39
332	0.42
333	0.46
334	0.51
335	0.5
336	0.49
337	0.54
338	0.54
339	0.48
340	0.52
341	0.49
342	0.44
343	0.4
344	0.34
345	0.26
346	0.2
347	0.17
348	0.1
349	0.08
350	0.05
351	0.05
352	0.05
353	0.04
354	0.04
355	0.03
356	0.03
357	0.02
358	0.03
359	0.05
360	0.07
361	0.12
362	0.16
363	0.26
364	0.34
365	0.41
366	0.51
367	0.58
368	0.66
369	0.72
370	0.79
371	0.77
372	0.72
373	0.67
374	0.58
375	0.49
376	0.4
377	0.29
378	0.19
379	0.12
380	0.09
381	0.07
382	0.07
383	0.06
384	0.05
385	0.06
386	0.06
387	0.08
388	0.1
389	0.13
390	0.13
391	0.14
392	0.16
393	0.17
394	0.18
395	0.18
396	0.19
397	0.18
398	0.24
399	0.28
400	0.27
401	0.29
402	0.29
403	0.29
404	0.27
405	0.27
406	0.26
407	0.28
408	0.34
409	0.41
410	0.48
411	0.56
412	0.63
413	0.72
414	0.76
415	0.78
416	0.81
417	0.83
418	0.83
419	0.82
420	0.81
421	0.73
422	0.72
423	0.66
424	0.59
425	0.51
426	0.42
427	0.34
428	0.27
429	0.24
430	0.16
431	0.14
432	0.11
433	0.08
434	0.12
435	0.13
436	0.15
437	0.2
438	0.21
439	0.21
440	0.21
441	0.25
442	0.28
443	0.33
444	0.32
445	0.29
446	0.32
447	0.34
448	0.39
449	0.38
450	0.32
451	0.27
452	0.28
453	0.28
454	0.27
455	0.25
456	0.22
457	0.22
458	0.21
459	0.22
460	0.21
461	0.2
462	0.17
463	0.16
464	0.14
465	0.14
466	0.13
467	0.11
468	0.11
469	0.1
470	0.09
471	0.09
472	0.08
473	0.06
474	0.07
475	0.07
476	0.08
477	0.08
478	0.08
479	0.09
480	0.1
481	0.14
482	0.16
483	0.17
484	0.19
485	0.23
486	0.27
487	0.28
488	0.29
489	0.33
490	0.37
491	0.37
492	0.36
493	0.37
494	0.39
495	0.41
496	0.43
497	0.42
498	0.45
499	0.5
500	0.54
501	0.52
502	0.54
503	0.58
504	0.62
505	0.6
506	0.53
507	0.49
508	0.47
509	0.44
510	0.39
511	0.34
512	0.3

A0A067TBF6

3D AlphaFold-predicted Structure Viewer