Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

B6Q7T0

Protein Details
Accession B6Q7T0    Localization Confidence Medium Confidence Score 12.9
NoLS Segment(s)
PositionSequenceProtein Nature
197-223SKLDVQESRPQKKKKKTPGNSSEKFYFHydrophilic
NLS Segment(s)
PositionSequence
207-212QKKKKK
Subcellular Location(s) nucl 19.5, cyto_nucl 13.5, cyto 6.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR025602  BCP1_family  
Gene Ontology GO:0005634  C:nucleus  
GO:0015031  P:protein transport  
KEGG tmf:PMAA_036080  -  
Pfam View protein in Pfam  
PF13862  BCCIP  
Amino Acid Sequences MAKRKSLKDNDNDVSMRDDDDSGSDSDVELVNVEFEWFDPQPAVDFHGLKTLLRQLLDTDAQSFNLSALADLILSQPLLGSTVKVDGNETDPYAFLSVLNISEHKDKQVIKDLTKYIAQKSTSNPSLAPLAQLLADPENPPSIGLILTERLINIPAEVVPPMYTMLQEEITWALEEKEPYNFSHYIILSKTYEEVESKLDVQESRPQKKKKKTPGNSSEKFYFHPEDEVLERHTLCHGTFEYTHKQAEGASDSKRAFQDFGIKPAGSLMLIEEKKFGDAVKAITDYLKPPV
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.51
2 0.42
3 0.34
4 0.25
5 0.22
6 0.15
7 0.16
8 0.17
9 0.14
10 0.14
11 0.13
12 0.11
13 0.12
14 0.12
15 0.1
16 0.08
17 0.08
18 0.07
19 0.07
20 0.07
21 0.06
22 0.06
23 0.11
24 0.1
25 0.11
26 0.11
27 0.11
28 0.13
29 0.13
30 0.17
31 0.16
32 0.16
33 0.16
34 0.22
35 0.22
36 0.2
37 0.22
38 0.25
39 0.24
40 0.23
41 0.23
42 0.18
43 0.22
44 0.24
45 0.22
46 0.19
47 0.17
48 0.18
49 0.18
50 0.16
51 0.12
52 0.11
53 0.1
54 0.07
55 0.07
56 0.06
57 0.05
58 0.06
59 0.06
60 0.05
61 0.05
62 0.05
63 0.04
64 0.04
65 0.06
66 0.06
67 0.05
68 0.06
69 0.09
70 0.1
71 0.1
72 0.11
73 0.1
74 0.13
75 0.14
76 0.14
77 0.11
78 0.11
79 0.11
80 0.11
81 0.1
82 0.07
83 0.07
84 0.07
85 0.07
86 0.08
87 0.08
88 0.09
89 0.14
90 0.14
91 0.14
92 0.18
93 0.18
94 0.21
95 0.31
96 0.33
97 0.3
98 0.36
99 0.36
100 0.34
101 0.37
102 0.35
103 0.27
104 0.29
105 0.29
106 0.25
107 0.27
108 0.32
109 0.3
110 0.29
111 0.27
112 0.22
113 0.23
114 0.21
115 0.18
116 0.11
117 0.09
118 0.08
119 0.08
120 0.08
121 0.06
122 0.07
123 0.07
124 0.07
125 0.07
126 0.07
127 0.07
128 0.06
129 0.06
130 0.05
131 0.05
132 0.05
133 0.05
134 0.06
135 0.06
136 0.05
137 0.05
138 0.06
139 0.06
140 0.05
141 0.05
142 0.04
143 0.05
144 0.05
145 0.05
146 0.05
147 0.05
148 0.06
149 0.06
150 0.05
151 0.05
152 0.07
153 0.07
154 0.07
155 0.07
156 0.07
157 0.07
158 0.07
159 0.07
160 0.07
161 0.08
162 0.09
163 0.09
164 0.11
165 0.12
166 0.12
167 0.17
168 0.16
169 0.16
170 0.19
171 0.19
172 0.18
173 0.18
174 0.2
175 0.16
176 0.16
177 0.16
178 0.12
179 0.13
180 0.12
181 0.12
182 0.11
183 0.12
184 0.13
185 0.12
186 0.13
187 0.13
188 0.14
189 0.21
190 0.28
191 0.35
192 0.44
193 0.52
194 0.6
195 0.71
196 0.79
197 0.82
198 0.85
199 0.86
200 0.88
201 0.91
202 0.92
203 0.86
204 0.82
205 0.75
206 0.66
207 0.58
208 0.52
209 0.44
210 0.34
211 0.32
212 0.26
213 0.24
214 0.24
215 0.24
216 0.21
217 0.21
218 0.2
219 0.17
220 0.19
221 0.17
222 0.15
223 0.17
224 0.16
225 0.17
226 0.2
227 0.24
228 0.29
229 0.31
230 0.32
231 0.28
232 0.27
233 0.24
234 0.25
235 0.25
236 0.21
237 0.21
238 0.26
239 0.26
240 0.3
241 0.31
242 0.29
243 0.26
244 0.24
245 0.32
246 0.29
247 0.33
248 0.34
249 0.32
250 0.3
251 0.3
252 0.29
253 0.19
254 0.16
255 0.13
256 0.18
257 0.19
258 0.19
259 0.2
260 0.2
261 0.2
262 0.21
263 0.19
264 0.14
265 0.15
266 0.17
267 0.2
268 0.21
269 0.21
270 0.22
271 0.24