Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A067TMJ7

Protein Details
Accession A0A067TMJ7    Localization Confidence Medium Confidence Score 14.5
NoLS Segment(s)
PositionSequenceProtein Nature
35-66MIPKRLKKPKSTTPKDKPPKKSKHTKEPEEVQBasic
NLS Segment(s)
PositionSequence
22-60PTLKRKAAEVLKSMIPKRLKKPKSTTPKDKPPKKSKHTK
Subcellular Location(s) nucl 25.5, cyto_nucl 13.5
Family & Domain DBs
Amino Acid Sequences MADNPDKANKANVSKSGRASEPTLKRKAAEVLKSMIPKRLKKPKSTTPKDKPPKKSKHTKEPEEVQEEPPIAPSGAAAAPSEPRQRQHPESEE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.5
2 0.52
3 0.5
4 0.46
5 0.43
6 0.42
7 0.43
8 0.46
9 0.49
10 0.5
11 0.47
12 0.46
13 0.45
14 0.48
15 0.45
16 0.4
17 0.35
18 0.33
19 0.36
20 0.4
21 0.38
22 0.37
23 0.37
24 0.38
25 0.44
26 0.51
27 0.52
28 0.56
29 0.63
30 0.66
31 0.71
32 0.75
33 0.77
34 0.75
35 0.82
36 0.84
37 0.85
38 0.85
39 0.85
40 0.86
41 0.84
42 0.86
43 0.84
44 0.85
45 0.86
46 0.84
47 0.81
48 0.79
49 0.76
50 0.71
51 0.65
52 0.55
53 0.48
54 0.41
55 0.33
56 0.27
57 0.21
58 0.15
59 0.12
60 0.1
61 0.09
62 0.09
63 0.1
64 0.08
65 0.08
66 0.11
67 0.16
68 0.24
69 0.24
70 0.27
71 0.33
72 0.41
73 0.46