Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A067SYT6

Protein Details
Accession A0A067SYT6    Localization Confidence Medium Confidence Score 13.1
NoLS Segment(s)
PositionSequenceProtein Nature
1-24MRRPTTRHRQREGSSPRRRRETRFBasic
NLS Segment(s)
PositionSequence
17-18RR
Subcellular Location(s) nucl 18.5, cyto_nucl 10, mito 8
Family & Domain DBs
Amino Acid Sequences MRRPTTRHRQREGSSPRRRRETRFTVSVLLASDGTILPMKATYSGKNSRSCPSPNAQHYDDQTWAGFILEESGKRIRENDVLDKLKTTRSFIDQILAPNYDNAKV
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.8
2 0.8
3 0.8
4 0.81
5 0.82
6 0.79
7 0.79
8 0.77
9 0.75
10 0.7
11 0.65
12 0.58
13 0.53
14 0.47
15 0.37
16 0.28
17 0.19
18 0.14
19 0.11
20 0.08
21 0.08
22 0.07
23 0.06
24 0.05
25 0.06
26 0.06
27 0.08
28 0.1
29 0.11
30 0.17
31 0.24
32 0.28
33 0.32
34 0.35
35 0.35
36 0.38
37 0.38
38 0.35
39 0.33
40 0.36
41 0.35
42 0.38
43 0.37
44 0.36
45 0.36
46 0.35
47 0.31
48 0.24
49 0.2
50 0.15
51 0.13
52 0.1
53 0.08
54 0.05
55 0.07
56 0.07
57 0.07
58 0.1
59 0.13
60 0.14
61 0.15
62 0.16
63 0.17
64 0.21
65 0.26
66 0.31
67 0.37
68 0.39
69 0.4
70 0.41
71 0.39
72 0.4
73 0.37
74 0.33
75 0.28
76 0.3
77 0.33
78 0.31
79 0.34
80 0.3
81 0.32
82 0.32
83 0.3
84 0.25
85 0.25