Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A067S4S1

Protein Details
Accession A0A067S4S1    Localization Confidence Medium Confidence Score 13.8
NoLS Segment(s)
PositionSequenceProtein Nature
122-157REKDRCGDKAPNRSPRPKPRRPRKPKTPLPLEMWADBasic
NLS Segment(s)
PositionSequence
130-147KAPNRSPRPKPRRPRKPK
Subcellular Location(s) nucl 22.5, cyto_nucl 14, cyto 2.5
Family & Domain DBs
Amino Acid Sequences MSGQSGRLANTNPRSKARSNLLIPEPDPNPSASSESFQQRSLCARPLLGGTDHLTAESEERRPPTLRQSHLRANPKAAQRSPGSRSCCTLSAFQTRRPLPDPDPTQEPSRHPHFDDPKPDQREKDRCGDKAPNRSPRPKPRRPRKPKTPLPLEMWADP
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.54
2 0.54
3 0.59
4 0.58
5 0.58
6 0.53
7 0.56
8 0.55
9 0.54
10 0.51
11 0.49
12 0.41
13 0.35
14 0.32
15 0.25
16 0.22
17 0.19
18 0.22
19 0.17
20 0.19
21 0.21
22 0.27
23 0.27
24 0.28
25 0.27
26 0.25
27 0.29
28 0.3
29 0.3
30 0.24
31 0.22
32 0.21
33 0.21
34 0.22
35 0.17
36 0.16
37 0.14
38 0.15
39 0.14
40 0.13
41 0.13
42 0.11
43 0.12
44 0.12
45 0.12
46 0.13
47 0.14
48 0.17
49 0.18
50 0.2
51 0.27
52 0.33
53 0.36
54 0.4
55 0.44
56 0.49
57 0.55
58 0.62
59 0.53
60 0.51
61 0.51
62 0.51
63 0.5
64 0.43
65 0.39
66 0.33
67 0.37
68 0.37
69 0.38
70 0.38
71 0.33
72 0.35
73 0.33
74 0.33
75 0.3
76 0.28
77 0.25
78 0.3
79 0.32
80 0.34
81 0.4
82 0.38
83 0.4
84 0.4
85 0.41
86 0.34
87 0.41
88 0.4
89 0.36
90 0.4
91 0.39
92 0.41
93 0.39
94 0.39
95 0.36
96 0.38
97 0.37
98 0.35
99 0.42
100 0.45
101 0.49
102 0.55
103 0.57
104 0.61
105 0.64
106 0.65
107 0.62
108 0.64
109 0.66
110 0.61
111 0.63
112 0.61
113 0.56
114 0.6
115 0.65
116 0.63
117 0.65
118 0.7
119 0.7
120 0.71
121 0.79
122 0.82
123 0.83
124 0.86
125 0.86
126 0.88
127 0.89
128 0.92
129 0.94
130 0.94
131 0.94
132 0.95
133 0.95
134 0.94
135 0.93
136 0.89
137 0.85
138 0.82