Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A067SWW3

Protein Details
Accession A0A067SWW3    Localization Confidence Low Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
15-34ATPTREIRLRHRRRLGSPRLBasic
NLS Segment(s)
Subcellular Location(s) mito 21, cyto 3, pero 2
Family & Domain DBs
Amino Acid Sequences MWALVRCPPLQHVRATPTREIRLRHRRRLGSPRLLFVWSTGTPFVEQRNEVTRTAETTGIVETAVRVSTDSLRPGTFPFALRASTLL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.47
2 0.5
3 0.51
4 0.5
5 0.54
6 0.54
7 0.53
8 0.57
9 0.61
10 0.66
11 0.69
12 0.71
13 0.71
14 0.75
15 0.81
16 0.8
17 0.79
18 0.71
19 0.64
20 0.57
21 0.51
22 0.42
23 0.33
24 0.28
25 0.17
26 0.16
27 0.14
28 0.12
29 0.12
30 0.13
31 0.14
32 0.11
33 0.11
34 0.12
35 0.17
36 0.2
37 0.19
38 0.21
39 0.19
40 0.19
41 0.21
42 0.19
43 0.14
44 0.12
45 0.12
46 0.1
47 0.09
48 0.07
49 0.06
50 0.06
51 0.06
52 0.05
53 0.05
54 0.07
55 0.11
56 0.14
57 0.16
58 0.18
59 0.18
60 0.19
61 0.2
62 0.23
63 0.22
64 0.21
65 0.22
66 0.21
67 0.22