Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A067SK10

Protein Details
Accession A0A067SK10   
Localization Confidence Low
Confidence Score 8.4
NoLS Segment(s)
PositionSequenceProtein Nature
83-113ILLFRDTKDHHRRRRIKSNTRRKDVRGAKSTBasic
NLS Segment(s)
PositionSequence
92-112HHRRRRIKSNTRRKDVRGAKS
Subcellular Location(s) mito 12, extr 6, cyto 5, nucl 1, plas 1, pero 1, E.R. 1
Family & Domain DBs
Amino Acid Sequences MGAASARQALPALSPLPLACATSPPALPRHMLSHGLGWTARCLGGSTLRDCEVVVVQVGTVRLQPPPNGLTTLIVTFLARSNILLFRDTKDHHRRRRIKSNTRRKDVRGAKSTVR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.11
2 0.1
3 0.13
4 0.13
5 0.14
6 0.11
7 0.12
8 0.15
9 0.16
10 0.17
11 0.16
12 0.19
13 0.19
14 0.2
15 0.2
16 0.21
17 0.21
18 0.23
19 0.21
20 0.22
21 0.21
22 0.21
23 0.2
24 0.16
25 0.14
26 0.12
27 0.11
28 0.08
29 0.08
30 0.08
31 0.13
32 0.15
33 0.16
34 0.17
35 0.17
36 0.17
37 0.16
38 0.16
39 0.11
40 0.09
41 0.07
42 0.05
43 0.04
44 0.05
45 0.05
46 0.05
47 0.05
48 0.06
49 0.07
50 0.08
51 0.09
52 0.11
53 0.12
54 0.13
55 0.13
56 0.13
57 0.12
58 0.13
59 0.12
60 0.1
61 0.09
62 0.08
63 0.08
64 0.09
65 0.08
66 0.07
67 0.07
68 0.09
69 0.11
70 0.13
71 0.14
72 0.14
73 0.15
74 0.21
75 0.23
76 0.31
77 0.4
78 0.49
79 0.57
80 0.67
81 0.75
82 0.79
83 0.88
84 0.89
85 0.89
86 0.91
87 0.92
88 0.92
89 0.92
90 0.9
91 0.84
92 0.84
93 0.82
94 0.82
95 0.78