Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

B6QUA8

Protein Details
Accession B6QUA8    Localization Confidence Medium Confidence Score 12.3
NoLS Segment(s)
PositionSequenceProtein Nature
39-59TSSRATRRRGAAQQHQRRYSSHydrophilic
333-368MYTISVRRQRKLKMKKHKFKKLLRKTRTLRRKLDKABasic
NLS Segment(s)
PositionSequence
339-368RRQRKLKMKKHKFKKLLRKTRTLRRKLDKA
Subcellular Location(s) mito 20, nucl 6
Family & Domain DBs
InterPro View protein in InterPro  
IPR013177  COX24_C  
KEGG tmf:PMAA_006940  -  
Pfam View protein in Pfam  
PF08213  COX24_C  
Amino Acid Sequences MLASSLRRAMRTTTSSHSASAAIVAFPNLLVPTTTSITTSSRATRRRGAAQQHQRRYSSSSSKPPVPPNDGSRPIDASSSQQAPANPSAGRKVKESQGRKAGAGAAGDVTKSRQSSAALLNLPSVPSTQDTPVEDIKVASFFSIHRPISVSAPVPPTSTEKAFNTIFEANKSRRGNRAADVLNTLTSAVASMEHAMHGQSQQNSLRHAVTQASVSNGEAGARIIHLDEVSEEELHASIAEFASRLTPFQPPAAPEPYNPEDVLEAAEAATGNDDADIRTYSTVLTIRETAYADGQRTFETSFAPLVPSEEHNIEEPVIDAGKSYIERTVNRTMYTISVRRQRKLKMKKHKFKKLLRKTRTLRRKLDKA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.42
2 0.42
3 0.41
4 0.38
5 0.31
6 0.27
7 0.24
8 0.18
9 0.13
10 0.12
11 0.11
12 0.1
13 0.09
14 0.1
15 0.08
16 0.07
17 0.07
18 0.08
19 0.11
20 0.13
21 0.14
22 0.14
23 0.16
24 0.17
25 0.19
26 0.22
27 0.26
28 0.32
29 0.38
30 0.42
31 0.48
32 0.52
33 0.59
34 0.63
35 0.66
36 0.68
37 0.74
38 0.79
39 0.81
40 0.81
41 0.74
42 0.68
43 0.64
44 0.61
45 0.59
46 0.57
47 0.57
48 0.57
49 0.63
50 0.66
51 0.69
52 0.68
53 0.66
54 0.63
55 0.61
56 0.64
57 0.63
58 0.6
59 0.54
60 0.49
61 0.43
62 0.39
63 0.32
64 0.27
65 0.24
66 0.24
67 0.22
68 0.22
69 0.22
70 0.25
71 0.26
72 0.25
73 0.21
74 0.2
75 0.27
76 0.3
77 0.31
78 0.3
79 0.33
80 0.37
81 0.46
82 0.5
83 0.51
84 0.54
85 0.55
86 0.51
87 0.49
88 0.43
89 0.36
90 0.3
91 0.21
92 0.14
93 0.12
94 0.11
95 0.1
96 0.09
97 0.1
98 0.1
99 0.1
100 0.11
101 0.12
102 0.15
103 0.18
104 0.22
105 0.21
106 0.21
107 0.21
108 0.2
109 0.19
110 0.16
111 0.13
112 0.09
113 0.09
114 0.1
115 0.11
116 0.13
117 0.14
118 0.17
119 0.18
120 0.18
121 0.16
122 0.15
123 0.14
124 0.12
125 0.11
126 0.07
127 0.07
128 0.06
129 0.11
130 0.18
131 0.17
132 0.17
133 0.19
134 0.2
135 0.22
136 0.23
137 0.19
138 0.15
139 0.18
140 0.18
141 0.17
142 0.17
143 0.19
144 0.19
145 0.2
146 0.2
147 0.18
148 0.22
149 0.21
150 0.2
151 0.2
152 0.2
153 0.19
154 0.19
155 0.23
156 0.2
157 0.28
158 0.3
159 0.29
160 0.32
161 0.35
162 0.35
163 0.32
164 0.38
165 0.31
166 0.29
167 0.29
168 0.24
169 0.2
170 0.18
171 0.16
172 0.08
173 0.07
174 0.06
175 0.04
176 0.03
177 0.03
178 0.04
179 0.04
180 0.04
181 0.05
182 0.05
183 0.05
184 0.07
185 0.1
186 0.09
187 0.13
188 0.17
189 0.18
190 0.2
191 0.21
192 0.2
193 0.17
194 0.17
195 0.15
196 0.12
197 0.12
198 0.11
199 0.11
200 0.1
201 0.1
202 0.09
203 0.08
204 0.08
205 0.06
206 0.06
207 0.05
208 0.04
209 0.05
210 0.04
211 0.05
212 0.04
213 0.04
214 0.04
215 0.06
216 0.07
217 0.07
218 0.07
219 0.07
220 0.07
221 0.07
222 0.06
223 0.05
224 0.04
225 0.04
226 0.04
227 0.04
228 0.04
229 0.07
230 0.07
231 0.07
232 0.08
233 0.11
234 0.12
235 0.14
236 0.16
237 0.16
238 0.2
239 0.26
240 0.25
241 0.23
242 0.3
243 0.3
244 0.3
245 0.28
246 0.24
247 0.19
248 0.18
249 0.19
250 0.11
251 0.08
252 0.06
253 0.06
254 0.06
255 0.05
256 0.06
257 0.05
258 0.04
259 0.05
260 0.05
261 0.05
262 0.06
263 0.07
264 0.07
265 0.08
266 0.08
267 0.08
268 0.1
269 0.12
270 0.12
271 0.13
272 0.14
273 0.14
274 0.16
275 0.17
276 0.16
277 0.18
278 0.2
279 0.19
280 0.19
281 0.2
282 0.18
283 0.19
284 0.19
285 0.15
286 0.13
287 0.13
288 0.13
289 0.12
290 0.13
291 0.11
292 0.13
293 0.14
294 0.15
295 0.17
296 0.17
297 0.18
298 0.18
299 0.19
300 0.17
301 0.15
302 0.14
303 0.11
304 0.11
305 0.09
306 0.08
307 0.07
308 0.1
309 0.11
310 0.11
311 0.14
312 0.18
313 0.21
314 0.26
315 0.36
316 0.36
317 0.36
318 0.37
319 0.33
320 0.33
321 0.39
322 0.39
323 0.37
324 0.43
325 0.48
326 0.53
327 0.59
328 0.64
329 0.68
330 0.73
331 0.77
332 0.79
333 0.85
334 0.89
335 0.93
336 0.95
337 0.94
338 0.94
339 0.95
340 0.95
341 0.94
342 0.92
343 0.92
344 0.91
345 0.91
346 0.92
347 0.9
348 0.9