Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A067SCC1

Protein Details
Accession A0A067SCC1    Localization Confidence Medium Confidence Score 13.7
NoLS Segment(s)
PositionSequenceProtein Nature
1-22MDSKPSKEDQIRQRRKVRYVTNHydrophilic
NLS Segment(s)
PositionSequence
29-36KARIRARR
Subcellular Location(s) nucl 22.5, cyto_nucl 13.5, cyto 3.5
Family & Domain DBs
Amino Acid Sequences MDSKPSKEDQIRQRRKVRYVTNIEGEREKARIRARRNKQALQDPVEIQRRRECHRQAQARYRAANRAKLKTQAWQYRLKVKREKESLHDDEEYERLMAQVLEDEDS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.81
2 0.81
3 0.82
4 0.79
5 0.78
6 0.77
7 0.74
8 0.73
9 0.68
10 0.63
11 0.56
12 0.49
13 0.4
14 0.34
15 0.28
16 0.26
17 0.3
18 0.35
19 0.43
20 0.51
21 0.59
22 0.67
23 0.73
24 0.74
25 0.73
26 0.75
27 0.71
28 0.66
29 0.6
30 0.5
31 0.49
32 0.52
33 0.46
34 0.39
35 0.37
36 0.35
37 0.37
38 0.44
39 0.42
40 0.42
41 0.51
42 0.58
43 0.6
44 0.67
45 0.7
46 0.66
47 0.65
48 0.58
49 0.58
50 0.52
51 0.54
52 0.5
53 0.47
54 0.45
55 0.47
56 0.46
57 0.45
58 0.51
59 0.5
60 0.48
61 0.52
62 0.52
63 0.57
64 0.62
65 0.64
66 0.63
67 0.61
68 0.67
69 0.67
70 0.68
71 0.64
72 0.67
73 0.63
74 0.6
75 0.54
76 0.45
77 0.39
78 0.36
79 0.31
80 0.21
81 0.17
82 0.12
83 0.11
84 0.1
85 0.08
86 0.1