Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A067S5Y1

Protein Details
Accession A0A067S5Y1   
Localization Confidence Medium
Confidence Score 12.8
NoLS Segment(s)
PositionSequenceProtein Nature
63-88KGNSKKATPDGKKKYQKRPSSKAIQPHydrophilic
NLS Segment(s)
PositionSequence
52-84ARVRRRANAAYKGNSKKATPDGKKKYQKRPSSK
Subcellular Location(s) nucl 13, cyto 6, mito 5, pero 3
Family & Domain DBs
Amino Acid Sequences MSVFEGLFPGPDDQFVQDMFFTLCTWHAYAKLRLHTTSTLTGLKELPREEAARVRRRANAAYKGNSKKATPDGKKKYQKRPSSKAIQPPNLQAPRYRRLCRRNLAIWTIKQLFNTDG
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.14
2 0.13
3 0.13
4 0.11
5 0.11
6 0.11
7 0.1
8 0.09
9 0.08
10 0.09
11 0.1
12 0.11
13 0.11
14 0.14
15 0.18
16 0.25
17 0.29
18 0.34
19 0.35
20 0.35
21 0.37
22 0.35
23 0.33
24 0.29
25 0.27
26 0.23
27 0.2
28 0.21
29 0.2
30 0.2
31 0.19
32 0.17
33 0.16
34 0.16
35 0.17
36 0.17
37 0.22
38 0.28
39 0.34
40 0.37
41 0.37
42 0.38
43 0.39
44 0.43
45 0.42
46 0.43
47 0.4
48 0.42
49 0.48
50 0.49
51 0.5
52 0.47
53 0.41
54 0.36
55 0.39
56 0.44
57 0.43
58 0.5
59 0.54
60 0.63
61 0.73
62 0.78
63 0.82
64 0.82
65 0.85
66 0.84
67 0.83
68 0.82
69 0.81
70 0.8
71 0.78
72 0.78
73 0.76
74 0.69
75 0.66
76 0.67
77 0.62
78 0.56
79 0.53
80 0.5
81 0.51
82 0.57
83 0.59
84 0.58
85 0.63
86 0.71
87 0.73
88 0.75
89 0.73
90 0.71
91 0.72
92 0.7
93 0.64
94 0.63
95 0.6
96 0.53
97 0.46