Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A067TRU8

Protein Details
Accession A0A067TRU8   
Localization Confidence Medium
Confidence Score 10.7
NoLS Segment(s)
PositionSequenceProtein Nature
34-53EKVLQKPPPVPKKRRLVSSNHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 22.5, cyto_nucl 13.5, cyto 3.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR015947  PUA-like_sf  
IPR036987  SRA-YDG_sf  
IPR003105  SRA_YDG  
IPR045134  UHRF1/2-like  
Gene Ontology GO:0005634  C:nucleus  
Pfam View protein in Pfam  
PF02182  SAD_SRA  
PROSITE View protein in PROSITE  
PS51015  YDG  
Amino Acid Sequences MVSSYELNKQENIRKNKELLMQLGFDKPLLEPIEKVLQKPPPVPKKRRLVSSNEEEEPISTKAQRVNFSDSAPESGPRRSSRNVGKVMDYNKEVIKASPVPVAYSSGVKTSDNSGPMGREDGPRQHNPKTYGPIPGVAVGTWWVTRAGCSADAIHAPWVGGISGGSQGAYSVALSGGYDDDVDLGYAFTYTGSGGRDLKGTKNAPKNLRTAPQSSDQTFDHNFNKMLLRSCESKKPVRVIRGFKVKSQYAPSEGYRYDGLYRVEKAWLEKGLNPKGYLVCKFIFKRLEGQPPLPVRGDSEDHDDDPVKDEDEEENDSA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.6
2 0.61
3 0.64
4 0.64
5 0.6
6 0.55
7 0.49
8 0.44
9 0.4
10 0.4
11 0.34
12 0.26
13 0.22
14 0.17
15 0.2
16 0.2
17 0.19
18 0.16
19 0.2
20 0.3
21 0.3
22 0.32
23 0.32
24 0.35
25 0.39
26 0.45
27 0.51
28 0.53
29 0.62
30 0.69
31 0.72
32 0.77
33 0.8
34 0.83
35 0.77
36 0.75
37 0.74
38 0.75
39 0.72
40 0.63
41 0.57
42 0.47
43 0.43
44 0.38
45 0.3
46 0.22
47 0.17
48 0.18
49 0.22
50 0.26
51 0.31
52 0.31
53 0.37
54 0.37
55 0.37
56 0.38
57 0.34
58 0.33
59 0.29
60 0.28
61 0.22
62 0.23
63 0.28
64 0.27
65 0.31
66 0.31
67 0.38
68 0.44
69 0.51
70 0.54
71 0.5
72 0.5
73 0.51
74 0.51
75 0.48
76 0.4
77 0.33
78 0.28
79 0.28
80 0.25
81 0.19
82 0.21
83 0.18
84 0.18
85 0.19
86 0.19
87 0.17
88 0.17
89 0.2
90 0.16
91 0.16
92 0.15
93 0.13
94 0.14
95 0.13
96 0.14
97 0.15
98 0.17
99 0.17
100 0.17
101 0.16
102 0.16
103 0.16
104 0.18
105 0.15
106 0.15
107 0.16
108 0.22
109 0.27
110 0.33
111 0.37
112 0.39
113 0.43
114 0.46
115 0.48
116 0.47
117 0.43
118 0.41
119 0.37
120 0.34
121 0.28
122 0.25
123 0.21
124 0.14
125 0.12
126 0.08
127 0.08
128 0.07
129 0.07
130 0.06
131 0.05
132 0.06
133 0.07
134 0.07
135 0.07
136 0.07
137 0.07
138 0.08
139 0.08
140 0.09
141 0.08
142 0.07
143 0.07
144 0.06
145 0.06
146 0.04
147 0.04
148 0.04
149 0.03
150 0.04
151 0.04
152 0.04
153 0.04
154 0.04
155 0.04
156 0.04
157 0.03
158 0.03
159 0.03
160 0.03
161 0.03
162 0.03
163 0.03
164 0.03
165 0.03
166 0.03
167 0.03
168 0.03
169 0.03
170 0.03
171 0.03
172 0.03
173 0.03
174 0.03
175 0.03
176 0.03
177 0.03
178 0.05
179 0.05
180 0.07
181 0.08
182 0.09
183 0.11
184 0.12
185 0.14
186 0.2
187 0.23
188 0.29
189 0.37
190 0.44
191 0.47
192 0.5
193 0.53
194 0.5
195 0.53
196 0.49
197 0.44
198 0.4
199 0.42
200 0.43
201 0.39
202 0.37
203 0.31
204 0.32
205 0.31
206 0.32
207 0.26
208 0.24
209 0.24
210 0.22
211 0.26
212 0.23
213 0.26
214 0.25
215 0.26
216 0.29
217 0.32
218 0.38
219 0.4
220 0.45
221 0.46
222 0.52
223 0.55
224 0.59
225 0.63
226 0.63
227 0.66
228 0.7
229 0.66
230 0.62
231 0.63
232 0.56
233 0.52
234 0.51
235 0.46
236 0.39
237 0.41
238 0.39
239 0.37
240 0.34
241 0.32
242 0.27
243 0.25
244 0.23
245 0.23
246 0.24
247 0.22
248 0.24
249 0.23
250 0.25
251 0.25
252 0.26
253 0.26
254 0.28
255 0.26
256 0.28
257 0.36
258 0.41
259 0.43
260 0.4
261 0.39
262 0.39
263 0.42
264 0.41
265 0.36
266 0.3
267 0.35
268 0.37
269 0.41
270 0.41
271 0.37
272 0.43
273 0.46
274 0.54
275 0.51
276 0.52
277 0.53
278 0.53
279 0.55
280 0.49
281 0.41
282 0.34
283 0.34
284 0.35
285 0.29
286 0.33
287 0.33
288 0.31
289 0.34
290 0.33
291 0.29
292 0.3
293 0.28
294 0.22
295 0.19
296 0.2
297 0.19
298 0.21