Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A067TTL1

Protein Details
Accession A0A067TTL1   
Localization Confidence Low
Confidence Score 9.8
NoLS Segment(s)
PositionSequenceProtein Nature
1-22MHARRRRLNKGRRSGKIAKFNEBasic
NLS Segment(s)
PositionSequence
4-17RRRRLNKGRRSGKI
Subcellular Location(s) mito 15, mito_nucl 12.333, nucl 7.5, cyto_nucl 6.666
Family & Domain DBs
Amino Acid Sequences MHARRRRLNKGRRSGKIAKFNEGTFSEVTSSTTYTTKMSIHDLVVRDVIPTTEDKRGTTVQRKPPLVDGNGVESKGKFEWKWKVGSSVKVNPIRVGC
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.85
2 0.83
3 0.83
4 0.76
5 0.72
6 0.65
7 0.58
8 0.54
9 0.45
10 0.39
11 0.28
12 0.26
13 0.2
14 0.17
15 0.18
16 0.13
17 0.13
18 0.11
19 0.12
20 0.12
21 0.11
22 0.12
23 0.11
24 0.12
25 0.15
26 0.14
27 0.15
28 0.17
29 0.17
30 0.17
31 0.17
32 0.15
33 0.12
34 0.11
35 0.1
36 0.07
37 0.08
38 0.09
39 0.13
40 0.14
41 0.14
42 0.17
43 0.2
44 0.25
45 0.32
46 0.38
47 0.43
48 0.51
49 0.52
50 0.5
51 0.53
52 0.52
53 0.46
54 0.4
55 0.32
56 0.31
57 0.31
58 0.3
59 0.25
60 0.19
61 0.2
62 0.19
63 0.22
64 0.16
65 0.22
66 0.31
67 0.34
68 0.4
69 0.39
70 0.47
71 0.47
72 0.55
73 0.56
74 0.55
75 0.6
76 0.61
77 0.61