Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A067SYN4

Protein Details
Accession A0A067SYN4   
Localization Confidence Low
Confidence Score 7
NoLS Segment(s)
PositionSequenceProtein Nature
10-33NVEEKKWQERKEKMQDTKKTEKEDBasic
NLS Segment(s)
Subcellular Location(s) cyto_nucl 9.833, cyto 9.5, nucl 9, mito_nucl 8.833, mito 7.5
Family & Domain DBs
Amino Acid Sequences MVRGLIPNLNVEEKKWQERKEKMQDTKKTEKEDSQKAKLEVDLEIGNAKKNAGMEARQKVMSQLKMTLIAEVMAEVMVEVKLNKKVLTSMVESQELEAESKWKEH
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.41
2 0.46
3 0.5
4 0.54
5 0.62
6 0.71
7 0.74
8 0.79
9 0.79
10 0.82
11 0.84
12 0.83
13 0.85
14 0.8
15 0.76
16 0.68
17 0.66
18 0.64
19 0.65
20 0.64
21 0.6
22 0.59
23 0.54
24 0.51
25 0.45
26 0.38
27 0.28
28 0.22
29 0.16
30 0.11
31 0.12
32 0.11
33 0.11
34 0.1
35 0.09
36 0.08
37 0.08
38 0.09
39 0.08
40 0.12
41 0.17
42 0.2
43 0.22
44 0.22
45 0.21
46 0.23
47 0.27
48 0.26
49 0.21
50 0.2
51 0.19
52 0.21
53 0.21
54 0.18
55 0.13
56 0.11
57 0.09
58 0.07
59 0.07
60 0.04
61 0.04
62 0.03
63 0.03
64 0.03
65 0.04
66 0.04
67 0.07
68 0.11
69 0.12
70 0.13
71 0.13
72 0.15
73 0.18
74 0.21
75 0.24
76 0.26
77 0.28
78 0.31
79 0.3
80 0.29
81 0.28
82 0.25
83 0.21
84 0.16
85 0.15