Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A067S9H9

Protein Details
Accession A0A067S9H9    Localization Confidence Low Confidence Score 8.5
NoLS Segment(s)
PositionSequenceProtein Nature
147-172CEIQNGKKTQYRKRSPPRGTPRLELQHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 14cyto_nucl 14, cyto 12
Family & Domain DBs
InterPro View protein in InterPro  
IPR005824  KOW  
IPR014722  Rib_L2_dom2  
IPR008991  Translation_prot_SH3-like_sf  
Pfam View protein in Pfam  
PF00467  KOW  
Amino Acid Sequences MDLRKDFRAGDQVMVTSGDQKGMKGWVVEVLENRAVVFDLDKLQQVEVLFLHLEFYEEWDSVCLRSLSDVSKPKNEDDRKMKHDPNRKFIGKEVMIVGANHFKACRGVIRDTTWEGEASVELALFNHPRQEKFHLSHLRLVRENSLCEIQNGKKTQYRKRSPPRGTPRLELQRPSLDDI
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.26
2 0.22
3 0.17
4 0.16
5 0.17
6 0.15
7 0.15
8 0.16
9 0.17
10 0.18
11 0.15
12 0.15
13 0.16
14 0.17
15 0.19
16 0.18
17 0.2
18 0.2
19 0.19
20 0.19
21 0.14
22 0.13
23 0.11
24 0.1
25 0.08
26 0.09
27 0.1
28 0.13
29 0.13
30 0.13
31 0.14
32 0.14
33 0.13
34 0.11
35 0.11
36 0.09
37 0.08
38 0.09
39 0.07
40 0.08
41 0.06
42 0.1
43 0.1
44 0.1
45 0.1
46 0.1
47 0.1
48 0.1
49 0.12
50 0.09
51 0.07
52 0.08
53 0.09
54 0.1
55 0.16
56 0.23
57 0.24
58 0.29
59 0.31
60 0.33
61 0.41
62 0.43
63 0.45
64 0.47
65 0.51
66 0.53
67 0.58
68 0.61
69 0.59
70 0.66
71 0.63
72 0.61
73 0.62
74 0.57
75 0.51
76 0.47
77 0.48
78 0.38
79 0.34
80 0.27
81 0.2
82 0.19
83 0.18
84 0.17
85 0.12
86 0.12
87 0.11
88 0.1
89 0.09
90 0.09
91 0.1
92 0.13
93 0.13
94 0.16
95 0.19
96 0.22
97 0.24
98 0.25
99 0.26
100 0.23
101 0.19
102 0.16
103 0.13
104 0.11
105 0.08
106 0.07
107 0.05
108 0.04
109 0.05
110 0.06
111 0.07
112 0.08
113 0.13
114 0.15
115 0.16
116 0.21
117 0.27
118 0.32
119 0.34
120 0.44
121 0.47
122 0.47
123 0.53
124 0.54
125 0.53
126 0.5
127 0.48
128 0.45
129 0.39
130 0.38
131 0.34
132 0.33
133 0.28
134 0.26
135 0.3
136 0.27
137 0.33
138 0.34
139 0.35
140 0.37
141 0.44
142 0.53
143 0.58
144 0.64
145 0.68
146 0.76
147 0.83
148 0.86
149 0.9
150 0.91
151 0.9
152 0.85
153 0.8
154 0.8
155 0.8
156 0.77
157 0.7
158 0.65
159 0.63