Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A067TIS0

Protein Details
Accession A0A067TIS0    Localization Confidence Medium Confidence Score 11.7
NoLS Segment(s)
PositionSequenceProtein Nature
2-31QNRPSLNHVTRTRQRRRRPSRRQSASVHVAHydrophilic
NLS Segment(s)
PositionSequence
15-22QRRRRPSR
Subcellular Location(s) nucl 13.5, cyto_nucl 10.5, mito 8, cyto 4.5
Family & Domain DBs
Amino Acid Sequences MQNRPSLNHVTRTRQRRRRPSRRQSASVHVALDHFVSRPCIFVPGETADGSQSCVTSLSLLSLLPFFLPTFFSFQS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.75
2 0.81
3 0.83
4 0.89
5 0.9
6 0.93
7 0.94
8 0.94
9 0.93
10 0.89
11 0.83
12 0.8
13 0.75
14 0.65
15 0.54
16 0.43
17 0.34
18 0.28
19 0.23
20 0.15
21 0.09
22 0.07
23 0.09
24 0.09
25 0.09
26 0.09
27 0.11
28 0.1
29 0.1
30 0.12
31 0.12
32 0.14
33 0.13
34 0.13
35 0.11
36 0.11
37 0.13
38 0.1
39 0.08
40 0.07
41 0.08
42 0.08
43 0.08
44 0.08
45 0.07
46 0.07
47 0.07
48 0.07
49 0.07
50 0.07
51 0.07
52 0.07
53 0.06
54 0.07
55 0.09
56 0.1