Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A067SVX2

Protein Details
Accession A0A067SVX2    Localization Confidence Low Confidence Score 7
NoLS Segment(s)
PositionSequenceProtein Nature
30-51SFPRCRFAAKLRKTRLPTRAKAHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 17.5, mito_nucl 13, nucl 7.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR001737  KsgA/Erm  
IPR023165  rRNA_Ade_diMease-like_C  
IPR029063  SAM-dependent_MTases_sf  
Gene Ontology GO:0008168  F:methyltransferase activity  
GO:0003723  F:RNA binding  
GO:0032259  P:methylation  
GO:0006364  P:rRNA processing  
Pfam View protein in Pfam  
PF00398  RrnaAD  
Amino Acid Sequences MASTQLSRAIRQSSRCTPLELSRSITPSPSFPRCRFAAKLRKTRLPTRAKAIPESSVPGGEAPVASVIDDAQSSKLHLPPMEQWRTVFPDKKEAGKRSSIRNPATAKLLAESFVPAGSKDKIIIEASPGPGQLTRALLDLPKERIKKLIVIENFNDYLQYLKPLEELDPRVTVLPMFGKDWATYRKITDMGLLNDVEVTDWNQVHPQLQFIMHMTSGVDGEQLSAQLLRTIPDRQWLYQYGRVPLNFILTARMWERIIAPESVAARCKVSVMAQSVSEMSEAVPYDAMQPYSDHFHPDIHNQFEYKFGKLDLRRMGIPYTVANFIPLVKPIIEPGDLDYWDYCVRKLFVQKATPLEKCINSLGPGAYNLLPKLNDPSKPEDMVDLKKNPRSFTVEDWAKIVRAFKNWPFRPEDLGIDTIFITNVNKHT
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.56
2 0.55
3 0.55
4 0.52
5 0.55
6 0.56
7 0.5
8 0.46
9 0.44
10 0.46
11 0.43
12 0.42
13 0.35
14 0.34
15 0.39
16 0.43
17 0.47
18 0.46
19 0.51
20 0.51
21 0.56
22 0.56
23 0.58
24 0.6
25 0.62
26 0.7
27 0.72
28 0.78
29 0.78
30 0.81
31 0.81
32 0.8
33 0.76
34 0.74
35 0.73
36 0.68
37 0.67
38 0.61
39 0.54
40 0.46
41 0.45
42 0.37
43 0.31
44 0.27
45 0.21
46 0.18
47 0.15
48 0.12
49 0.08
50 0.08
51 0.07
52 0.07
53 0.07
54 0.06
55 0.06
56 0.07
57 0.07
58 0.08
59 0.08
60 0.1
61 0.13
62 0.16
63 0.18
64 0.18
65 0.21
66 0.27
67 0.37
68 0.4
69 0.39
70 0.37
71 0.38
72 0.45
73 0.48
74 0.47
75 0.39
76 0.43
77 0.44
78 0.52
79 0.57
80 0.56
81 0.54
82 0.57
83 0.59
84 0.58
85 0.65
86 0.65
87 0.6
88 0.61
89 0.6
90 0.53
91 0.53
92 0.45
93 0.36
94 0.29
95 0.26
96 0.2
97 0.16
98 0.15
99 0.1
100 0.09
101 0.09
102 0.08
103 0.1
104 0.11
105 0.11
106 0.11
107 0.12
108 0.13
109 0.14
110 0.14
111 0.15
112 0.17
113 0.19
114 0.18
115 0.18
116 0.16
117 0.15
118 0.16
119 0.14
120 0.12
121 0.1
122 0.1
123 0.11
124 0.11
125 0.14
126 0.17
127 0.2
128 0.25
129 0.27
130 0.26
131 0.3
132 0.3
133 0.32
134 0.32
135 0.35
136 0.31
137 0.34
138 0.35
139 0.35
140 0.34
141 0.29
142 0.26
143 0.18
144 0.16
145 0.11
146 0.13
147 0.1
148 0.09
149 0.1
150 0.11
151 0.13
152 0.15
153 0.18
154 0.17
155 0.17
156 0.17
157 0.17
158 0.16
159 0.14
160 0.11
161 0.1
162 0.09
163 0.09
164 0.1
165 0.1
166 0.11
167 0.14
168 0.17
169 0.17
170 0.17
171 0.17
172 0.19
173 0.19
174 0.18
175 0.19
176 0.19
177 0.18
178 0.19
179 0.18
180 0.15
181 0.14
182 0.14
183 0.1
184 0.07
185 0.07
186 0.07
187 0.07
188 0.07
189 0.08
190 0.08
191 0.1
192 0.1
193 0.1
194 0.09
195 0.09
196 0.09
197 0.09
198 0.09
199 0.08
200 0.08
201 0.07
202 0.06
203 0.06
204 0.05
205 0.05
206 0.04
207 0.04
208 0.04
209 0.04
210 0.04
211 0.04
212 0.04
213 0.05
214 0.06
215 0.06
216 0.08
217 0.09
218 0.1
219 0.16
220 0.18
221 0.17
222 0.2
223 0.23
224 0.26
225 0.29
226 0.31
227 0.29
228 0.3
229 0.29
230 0.28
231 0.24
232 0.22
233 0.17
234 0.15
235 0.14
236 0.11
237 0.13
238 0.12
239 0.13
240 0.11
241 0.11
242 0.12
243 0.13
244 0.14
245 0.13
246 0.12
247 0.13
248 0.14
249 0.15
250 0.16
251 0.13
252 0.12
253 0.12
254 0.12
255 0.1
256 0.1
257 0.13
258 0.15
259 0.15
260 0.15
261 0.15
262 0.15
263 0.15
264 0.13
265 0.09
266 0.06
267 0.07
268 0.07
269 0.07
270 0.06
271 0.06
272 0.09
273 0.1
274 0.1
275 0.09
276 0.09
277 0.1
278 0.15
279 0.15
280 0.16
281 0.16
282 0.18
283 0.19
284 0.26
285 0.3
286 0.29
287 0.3
288 0.28
289 0.27
290 0.32
291 0.32
292 0.26
293 0.22
294 0.19
295 0.26
296 0.27
297 0.34
298 0.32
299 0.34
300 0.34
301 0.34
302 0.35
303 0.28
304 0.27
305 0.22
306 0.18
307 0.17
308 0.16
309 0.15
310 0.14
311 0.14
312 0.13
313 0.13
314 0.12
315 0.11
316 0.11
317 0.12
318 0.14
319 0.13
320 0.12
321 0.14
322 0.17
323 0.16
324 0.17
325 0.16
326 0.16
327 0.19
328 0.19
329 0.17
330 0.16
331 0.18
332 0.21
333 0.28
334 0.33
335 0.37
336 0.42
337 0.46
338 0.5
339 0.56
340 0.53
341 0.5
342 0.48
343 0.41
344 0.39
345 0.37
346 0.32
347 0.26
348 0.27
349 0.24
350 0.2
351 0.2
352 0.2
353 0.19
354 0.19
355 0.18
356 0.19
357 0.18
358 0.18
359 0.25
360 0.27
361 0.3
362 0.32
363 0.39
364 0.41
365 0.42
366 0.42
367 0.4
368 0.4
369 0.43
370 0.46
371 0.46
372 0.48
373 0.53
374 0.55
375 0.51
376 0.51
377 0.52
378 0.48
379 0.46
380 0.5
381 0.5
382 0.47
383 0.48
384 0.44
385 0.38
386 0.36
387 0.35
388 0.28
389 0.27
390 0.34
391 0.4
392 0.5
393 0.54
394 0.57
395 0.59
396 0.58
397 0.59
398 0.55
399 0.52
400 0.45
401 0.42
402 0.36
403 0.3
404 0.28
405 0.22
406 0.18
407 0.14
408 0.12