Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A067SHI0

Protein Details
Accession A0A067SHI0   
Localization Confidence Low
Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
14-35FFPFWAFRKPKKSQKGEKVGEIHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 7, cyto 5, plas 4, extr 4, vacu 3, pero 2, E.R. 2
Family & Domain DBs
Gene Ontology GO:0016020  C:membrane  
Amino Acid Sequences MPYISNFTIYLCAFFPFWAFRKPKKSQKGEKVGEINRIFSKLLIGLLVARVHQGRFSGKGTRIVQLVAFALFFAFFRLPKRKKVNCETTDVLTVHLCSP
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.14
2 0.15
3 0.15
4 0.17
5 0.24
6 0.29
7 0.35
8 0.44
9 0.53
10 0.62
11 0.68
12 0.75
13 0.77
14 0.82
15 0.86
16 0.8
17 0.79
18 0.77
19 0.69
20 0.68
21 0.58
22 0.5
23 0.4
24 0.37
25 0.3
26 0.22
27 0.2
28 0.11
29 0.1
30 0.07
31 0.06
32 0.05
33 0.06
34 0.06
35 0.05
36 0.06
37 0.06
38 0.06
39 0.07
40 0.08
41 0.08
42 0.11
43 0.13
44 0.18
45 0.19
46 0.27
47 0.28
48 0.29
49 0.28
50 0.26
51 0.23
52 0.19
53 0.18
54 0.1
55 0.08
56 0.06
57 0.06
58 0.05
59 0.05
60 0.06
61 0.07
62 0.07
63 0.14
64 0.24
65 0.28
66 0.37
67 0.48
68 0.54
69 0.63
70 0.73
71 0.78
72 0.71
73 0.76
74 0.7
75 0.63
76 0.61
77 0.52
78 0.43
79 0.33