Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A067T4H5

Protein Details
Accession A0A067T4H5    Localization Confidence Low Confidence Score 9.1
NoLS Segment(s)
PositionSequenceProtein Nature
24-56MYKQSKTRPAARSNRNKKNYNKRNIKNNKKVAEHydrophilic
NLS Segment(s)
PositionSequence
31-51RPAARSNRNKKNYNKRNIKNN
Subcellular Location(s) extr 9, E.R. 6, nucl 3, mito 3, golg 3, mito_nucl 3
Family & Domain DBs
Gene Ontology GO:0016020  C:membrane  
Amino Acid Sequences MALNILALINLFFVTVFPLALHQMYKQSKTRPAARSNRNKKNYNKRNIKNNKKVAEGDNEVDLSELARHLDGIDEV
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.06
2 0.06
3 0.06
4 0.06
5 0.07
6 0.08
7 0.09
8 0.1
9 0.08
10 0.16
11 0.19
12 0.23
13 0.27
14 0.3
15 0.37
16 0.42
17 0.5
18 0.48
19 0.55
20 0.6
21 0.66
22 0.73
23 0.76
24 0.81
25 0.8
26 0.81
27 0.81
28 0.83
29 0.83
30 0.83
31 0.83
32 0.8
33 0.83
34 0.87
35 0.88
36 0.87
37 0.86
38 0.8
39 0.74
40 0.7
41 0.63
42 0.59
43 0.52
44 0.43
45 0.36
46 0.32
47 0.27
48 0.24
49 0.2
50 0.13
51 0.09
52 0.08
53 0.07
54 0.07
55 0.07
56 0.07