Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A067SYK7

Protein Details
Accession A0A067SYK7    Localization Confidence Low Confidence Score 8.8
NoLS Segment(s)
PositionSequenceProtein Nature
34-55GFGIYFRKRYNRKQRNRLIAEGHydrophilic
NLS Segment(s)
PositionSequence
45-50RKQRNR
Subcellular Location(s) cyto 14, mito 6, extr 3, nucl 2
Family & Domain DBs
Gene Ontology GO:0016020  C:membrane  
Amino Acid Sequences SESEAASLGGKKAKTPVIAGSICGGVMLLAWIIGFGIYFRKRYNRKQRNRLIAEGKAAPREKDLEAPKEKVIIPPDPAVLLGQRKPGEMAFPERENSK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.24
2 0.25
3 0.26
4 0.29
5 0.29
6 0.28
7 0.25
8 0.21
9 0.19
10 0.17
11 0.13
12 0.05
13 0.05
14 0.04
15 0.03
16 0.02
17 0.02
18 0.02
19 0.02
20 0.02
21 0.02
22 0.02
23 0.08
24 0.1
25 0.11
26 0.13
27 0.22
28 0.28
29 0.39
30 0.51
31 0.56
32 0.65
33 0.75
34 0.82
35 0.84
36 0.82
37 0.78
38 0.71
39 0.62
40 0.55
41 0.49
42 0.41
43 0.36
44 0.32
45 0.26
46 0.23
47 0.23
48 0.21
49 0.24
50 0.28
51 0.3
52 0.34
53 0.36
54 0.35
55 0.35
56 0.35
57 0.32
58 0.31
59 0.26
60 0.25
61 0.24
62 0.24
63 0.21
64 0.21
65 0.18
66 0.18
67 0.19
68 0.18
69 0.23
70 0.23
71 0.24
72 0.25
73 0.25
74 0.26
75 0.25
76 0.31
77 0.3
78 0.32