Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A067S785

Protein Details
Accession A0A067S785    Localization Confidence Medium Confidence Score 14.5
NoLS Segment(s)
PositionSequenceProtein Nature
25-53AYTKHLRRALEAKKKKRDKKSGIKLIGDGBasic
127-151KAAALKKNKKFTKSKPKPVLLPKVIHydrophilic
NLS Segment(s)
PositionSequence
31-47RRALEAKKKKRDKKSGI
115-155NNKRAKAAWERRKAAALKKNKKFTKSKPKPVLLPKVIPKPR
Subcellular Location(s) cyto 12.5, cyto_nucl 11.5, nucl 9.5, mito 4
Family & Domain DBs
Amino Acid Sequences MACFARLRAGVHAFKLQASNILNEAYTKHLRRALEAKKKKRDKKSGIKLIGDGLPKMLSGDKFYELAQAKEKEVWEFARQKEARKDDWVAYDAAVEVWVVEDQEHRGKCETIKANNKRAKAAWERRKAAALKKNKKFTKSKPKPVLLPKVIPKPRLKDFLDGGNGGVDAGNVGDDAGDGSNEEESNGSTSDNDDE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.31
2 0.31
3 0.26
4 0.25
5 0.24
6 0.22
7 0.19
8 0.19
9 0.18
10 0.16
11 0.17
12 0.18
13 0.24
14 0.24
15 0.27
16 0.31
17 0.31
18 0.36
19 0.44
20 0.48
21 0.52
22 0.61
23 0.67
24 0.73
25 0.84
26 0.88
27 0.9
28 0.9
29 0.9
30 0.9
31 0.91
32 0.91
33 0.88
34 0.8
35 0.7
36 0.62
37 0.56
38 0.45
39 0.34
40 0.24
41 0.17
42 0.15
43 0.15
44 0.14
45 0.1
46 0.11
47 0.13
48 0.14
49 0.14
50 0.15
51 0.21
52 0.19
53 0.2
54 0.24
55 0.23
56 0.23
57 0.25
58 0.25
59 0.19
60 0.2
61 0.21
62 0.21
63 0.25
64 0.25
65 0.32
66 0.33
67 0.37
68 0.43
69 0.45
70 0.42
71 0.4
72 0.42
73 0.34
74 0.35
75 0.32
76 0.24
77 0.19
78 0.17
79 0.13
80 0.1
81 0.08
82 0.05
83 0.03
84 0.03
85 0.03
86 0.03
87 0.03
88 0.04
89 0.05
90 0.11
91 0.11
92 0.12
93 0.13
94 0.14
95 0.15
96 0.22
97 0.26
98 0.29
99 0.4
100 0.45
101 0.54
102 0.58
103 0.59
104 0.54
105 0.49
106 0.49
107 0.49
108 0.53
109 0.53
110 0.58
111 0.6
112 0.59
113 0.63
114 0.59
115 0.57
116 0.55
117 0.56
118 0.57
119 0.62
120 0.71
121 0.7
122 0.74
123 0.75
124 0.77
125 0.78
126 0.78
127 0.81
128 0.81
129 0.81
130 0.82
131 0.83
132 0.83
133 0.77
134 0.74
135 0.7
136 0.7
137 0.7
138 0.68
139 0.65
140 0.61
141 0.62
142 0.62
143 0.58
144 0.53
145 0.5
146 0.51
147 0.48
148 0.42
149 0.35
150 0.28
151 0.25
152 0.19
153 0.17
154 0.09
155 0.05
156 0.04
157 0.04
158 0.03
159 0.03
160 0.03
161 0.03
162 0.04
163 0.04
164 0.04
165 0.05
166 0.06
167 0.07
168 0.07
169 0.08
170 0.07
171 0.08
172 0.1
173 0.11
174 0.11
175 0.09