Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A067TPJ9

Protein Details
Accession A0A067TPJ9    Localization Confidence Medium Confidence Score 11.9
NoLS Segment(s)
PositionSequenceProtein Nature
24-50HFPSTPLLKKEKKSKKKKVDLSQDGTPHydrophilic
NLS Segment(s)
PositionSequence
32-41KKEKKSKKKK
Subcellular Location(s) nucl 20.5, cyto_nucl 14.833, mito_nucl 11.832, cyto 5
Family & Domain DBs
InterPro View protein in InterPro  
IPR013885  DUF1764_euk  
Pfam View protein in Pfam  
PF08576  DUF1764  
Amino Acid Sequences MSEIDDIFASKGKTKGVPLPLLSHFPSTPLLKKEKKSKKKKVDLSQDGTPPKPADTSNIASSSKKRPLPETVVDTSKHLEGPSKRQKFVANHDEDNNSKPHKVDQKKSSTDAEFKDSRGTGDRRTTEEGWLVYKEYELGIGDQGGGKPLRPI
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.25
2 0.32
3 0.36
4 0.4
5 0.38
6 0.41
7 0.41
8 0.43
9 0.4
10 0.36
11 0.29
12 0.25
13 0.28
14 0.26
15 0.29
16 0.29
17 0.36
18 0.4
19 0.47
20 0.56
21 0.63
22 0.71
23 0.77
24 0.83
25 0.85
26 0.89
27 0.93
28 0.92
29 0.92
30 0.9
31 0.85
32 0.8
33 0.75
34 0.68
35 0.58
36 0.51
37 0.4
38 0.31
39 0.26
40 0.21
41 0.18
42 0.2
43 0.23
44 0.22
45 0.25
46 0.25
47 0.25
48 0.28
49 0.31
50 0.32
51 0.32
52 0.31
53 0.31
54 0.36
55 0.41
56 0.42
57 0.41
58 0.37
59 0.36
60 0.35
61 0.32
62 0.28
63 0.22
64 0.18
65 0.13
66 0.15
67 0.14
68 0.24
69 0.34
70 0.37
71 0.37
72 0.39
73 0.45
74 0.44
75 0.51
76 0.51
77 0.46
78 0.44
79 0.45
80 0.47
81 0.42
82 0.39
83 0.34
84 0.26
85 0.22
86 0.2
87 0.24
88 0.31
89 0.38
90 0.45
91 0.5
92 0.58
93 0.62
94 0.65
95 0.64
96 0.57
97 0.55
98 0.48
99 0.45
100 0.37
101 0.34
102 0.35
103 0.29
104 0.28
105 0.29
106 0.29
107 0.29
108 0.36
109 0.38
110 0.38
111 0.45
112 0.44
113 0.4
114 0.41
115 0.36
116 0.3
117 0.28
118 0.25
119 0.19
120 0.18
121 0.16
122 0.12
123 0.12
124 0.1
125 0.1
126 0.09
127 0.09
128 0.1
129 0.11
130 0.11
131 0.14
132 0.13