Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A067T8X7

Protein Details
Accession A0A067T8X7    Localization Confidence Medium Confidence Score 10
NoLS Segment(s)
PositionSequenceProtein Nature
5-31VLIPAPKERRLRLRERRERTKGRSISGBasic
NLS Segment(s)
PositionSequence
10-27PKERRLRLRERRERTKGR
78-84KPKTKTK
Subcellular Location(s) mito 20.5, cyto_mito 14, cyto 6.5
Family & Domain DBs
Amino Acid Sequences MSAAVLIPAPKERRLRLRERRERTKGRSISGESKDSSVAGTADAGLQLKPAGGGKIDIAAGPGWAGHVVKTRKLEQEKPKTKTKMKTKTKMDGCLACRRKPRVIGPQHVINPVVDFFMPEPSPALSSAFGCDEAKDLIAMTLTVAVSPVSDLAWAEEGIGWFED
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.54
2 0.64
3 0.68
4 0.76
5 0.81
6 0.85
7 0.89
8 0.89
9 0.91
10 0.88
11 0.88
12 0.81
13 0.75
14 0.72
15 0.68
16 0.66
17 0.61
18 0.57
19 0.48
20 0.44
21 0.39
22 0.32
23 0.26
24 0.17
25 0.12
26 0.08
27 0.08
28 0.06
29 0.06
30 0.07
31 0.07
32 0.06
33 0.06
34 0.06
35 0.05
36 0.06
37 0.06
38 0.06
39 0.06
40 0.06
41 0.06
42 0.07
43 0.08
44 0.07
45 0.07
46 0.06
47 0.06
48 0.05
49 0.05
50 0.04
51 0.04
52 0.05
53 0.05
54 0.11
55 0.13
56 0.16
57 0.2
58 0.23
59 0.29
60 0.34
61 0.42
62 0.45
63 0.55
64 0.61
65 0.63
66 0.68
67 0.68
68 0.7
69 0.71
70 0.71
71 0.71
72 0.71
73 0.76
74 0.75
75 0.77
76 0.75
77 0.72
78 0.65
79 0.61
80 0.55
81 0.55
82 0.53
83 0.49
84 0.51
85 0.49
86 0.5
87 0.49
88 0.52
89 0.52
90 0.56
91 0.58
92 0.56
93 0.59
94 0.58
95 0.54
96 0.47
97 0.36
98 0.29
99 0.22
100 0.18
101 0.11
102 0.09
103 0.08
104 0.11
105 0.11
106 0.1
107 0.11
108 0.11
109 0.12
110 0.12
111 0.13
112 0.1
113 0.1
114 0.12
115 0.11
116 0.13
117 0.12
118 0.11
119 0.12
120 0.11
121 0.11
122 0.1
123 0.09
124 0.07
125 0.07
126 0.07
127 0.06
128 0.07
129 0.07
130 0.06
131 0.07
132 0.06
133 0.06
134 0.06
135 0.06
136 0.04
137 0.05
138 0.05
139 0.07
140 0.09
141 0.08
142 0.09
143 0.1
144 0.1