Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

B6QKP4

Protein Details
Accession B6QKP4    Localization Confidence Medium Confidence Score 12.6
NoLS Segment(s)
PositionSequenceProtein Nature
132-161LEKVIKLDEKNKKKRKLKGGRTLAQLKKQGBasic
NLS Segment(s)
PositionSequence
119-155LKRANLKAKAEADLEKVIKLDEKNKKKRKLKGGRTLA
Subcellular Location(s) nucl 17, mito_nucl 13, mito 7
Family & Domain DBs
InterPro View protein in InterPro  
IPR019189  Ribosomal_L27/L41_mit  
Gene Ontology GO:0005762  C:mitochondrial large ribosomal subunit  
GO:0003735  F:structural constituent of ribosome  
KEGG tmf:PMAA_054680  -  
Pfam View protein in Pfam  
PF09809  MRP-L27  
Amino Acid Sequences MKPSQPLMARLRLTTKQVNRGYYKGNRTGSMGFFLKTGTYIIDPSKLRTYVVPENLDSFKLTPFVTKSFLPTRTKYTTEEDRNGLTISKDRAFNGEDYLDLWEKLNPREHDDWSNKWRLKRANLKAKAEADLEKVIKLDEKNKKKRKLKGGRTLAQLKKQGL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.49
2 0.5
3 0.52
4 0.55
5 0.6
6 0.58
7 0.57
8 0.6
9 0.58
10 0.6
11 0.58
12 0.56
13 0.5
14 0.49
15 0.49
16 0.42
17 0.39
18 0.32
19 0.24
20 0.21
21 0.2
22 0.17
23 0.14
24 0.13
25 0.09
26 0.08
27 0.1
28 0.1
29 0.16
30 0.16
31 0.2
32 0.24
33 0.23
34 0.22
35 0.22
36 0.27
37 0.29
38 0.33
39 0.32
40 0.28
41 0.31
42 0.31
43 0.3
44 0.25
45 0.18
46 0.13
47 0.13
48 0.12
49 0.11
50 0.12
51 0.13
52 0.15
53 0.14
54 0.18
55 0.22
56 0.28
57 0.3
58 0.3
59 0.35
60 0.36
61 0.38
62 0.37
63 0.37
64 0.4
65 0.41
66 0.42
67 0.37
68 0.33
69 0.32
70 0.29
71 0.24
72 0.16
73 0.13
74 0.14
75 0.15
76 0.15
77 0.15
78 0.16
79 0.17
80 0.17
81 0.16
82 0.13
83 0.11
84 0.11
85 0.13
86 0.12
87 0.1
88 0.1
89 0.11
90 0.12
91 0.15
92 0.22
93 0.21
94 0.27
95 0.3
96 0.32
97 0.39
98 0.41
99 0.45
100 0.44
101 0.52
102 0.5
103 0.49
104 0.53
105 0.52
106 0.57
107 0.61
108 0.65
109 0.67
110 0.72
111 0.74
112 0.74
113 0.7
114 0.63
115 0.55
116 0.46
117 0.38
118 0.35
119 0.31
120 0.24
121 0.22
122 0.2
123 0.21
124 0.22
125 0.28
126 0.33
127 0.44
128 0.54
129 0.64
130 0.74
131 0.79
132 0.87
133 0.89
134 0.89
135 0.89
136 0.89
137 0.9
138 0.87
139 0.87
140 0.88
141 0.84
142 0.81