Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A067SRZ5

Protein Details
Accession A0A067SRZ5    Localization Confidence High Confidence Score 19
NoLS Segment(s)
PositionSequenceProtein Nature
1-21MPSKIEKMHRNESHKKGRTEKBasic
83-108NAPRNHPERLLKRKWHHENKKGWMGTBasic
NLS Segment(s)
PositionSequence
48-53KKNKGQ
57-57K
95-96RK
Subcellular Location(s) nucl 17.5, cyto_nucl 9.5, mito 8
Family & Domain DBs
Amino Acid Sequences MPSKIEKMHRNESHKKGRTEKTENELEDRSHLPIRGLIYSYQATTPKKKNKGQEAEKTRREGRTNAEIIRKTENRTEGDEMNNAPRNHPERLLKRKWHHENKKGWMGTGYRGGGSGNWRQRSNLK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.8
2 0.8
3 0.79
4 0.79
5 0.8
6 0.78
7 0.75
8 0.71
9 0.71
10 0.65
11 0.6
12 0.53
13 0.44
14 0.39
15 0.34
16 0.3
17 0.25
18 0.23
19 0.19
20 0.19
21 0.2
22 0.18
23 0.18
24 0.15
25 0.16
26 0.17
27 0.17
28 0.16
29 0.19
30 0.21
31 0.26
32 0.35
33 0.41
34 0.49
35 0.53
36 0.59
37 0.65
38 0.72
39 0.74
40 0.75
41 0.76
42 0.77
43 0.75
44 0.72
45 0.65
46 0.59
47 0.53
48 0.45
49 0.4
50 0.38
51 0.37
52 0.35
53 0.38
54 0.35
55 0.34
56 0.39
57 0.36
58 0.31
59 0.32
60 0.33
61 0.29
62 0.32
63 0.33
64 0.28
65 0.28
66 0.27
67 0.24
68 0.26
69 0.31
70 0.27
71 0.25
72 0.29
73 0.31
74 0.32
75 0.36
76 0.38
77 0.42
78 0.52
79 0.6
80 0.63
81 0.67
82 0.76
83 0.82
84 0.84
85 0.85
86 0.85
87 0.86
88 0.85
89 0.87
90 0.77
91 0.67
92 0.6
93 0.52
94 0.46
95 0.44
96 0.36
97 0.26
98 0.25
99 0.24
100 0.22
101 0.25
102 0.3
103 0.32
104 0.37
105 0.38