Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

B6QJH2

Protein Details
Accession B6QJH2    Localization Confidence Low Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
49-70LYSYTAIKKRRAKQPWRHWLIVHydrophilic
NLS Segment(s)
Subcellular Location(s) plas 11, mito 8, extr 4, mito_nucl 4
Family & Domain DBs
InterPro View protein in InterPro  
IPR013901  Anthrone_oxy  
Gene Ontology GO:0016020  C:membrane  
KEGG tmf:PMAA_100340  -  
Pfam View protein in Pfam  
PF08592  Anthrone_oxy  
Amino Acid Sequences MSTIGLQATAVVTGSFLSGAMMSLSLFAVRMYHYGHMVPPTMAVGTFLLYSYTAIKKRRAKQPWRHWLIVGLTTLTMVPFTWLVMAPINNRLFGLQKGSLAEPTVVTIAEAKELVIKWSRMHMTRSFMPLAGSVMGAMWIFTK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.05
2 0.05
3 0.04
4 0.04
5 0.04
6 0.05
7 0.05
8 0.05
9 0.04
10 0.05
11 0.05
12 0.05
13 0.05
14 0.04
15 0.05
16 0.06
17 0.07
18 0.09
19 0.1
20 0.11
21 0.12
22 0.13
23 0.14
24 0.15
25 0.13
26 0.11
27 0.11
28 0.1
29 0.09
30 0.08
31 0.07
32 0.06
33 0.06
34 0.06
35 0.06
36 0.06
37 0.06
38 0.08
39 0.12
40 0.16
41 0.19
42 0.28
43 0.36
44 0.43
45 0.53
46 0.61
47 0.67
48 0.74
49 0.82
50 0.85
51 0.83
52 0.76
53 0.66
54 0.59
55 0.5
56 0.41
57 0.3
58 0.19
59 0.13
60 0.11
61 0.11
62 0.07
63 0.06
64 0.03
65 0.04
66 0.04
67 0.04
68 0.04
69 0.04
70 0.05
71 0.06
72 0.08
73 0.08
74 0.15
75 0.15
76 0.15
77 0.15
78 0.15
79 0.15
80 0.15
81 0.18
82 0.13
83 0.13
84 0.15
85 0.15
86 0.15
87 0.15
88 0.14
89 0.1
90 0.1
91 0.09
92 0.07
93 0.07
94 0.08
95 0.07
96 0.08
97 0.08
98 0.07
99 0.09
100 0.1
101 0.12
102 0.15
103 0.16
104 0.16
105 0.22
106 0.27
107 0.28
108 0.32
109 0.34
110 0.37
111 0.4
112 0.44
113 0.39
114 0.35
115 0.33
116 0.28
117 0.26
118 0.2
119 0.15
120 0.1
121 0.09
122 0.09
123 0.08