Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A067TKW9

Protein Details
Accession A0A067TKW9   
Localization Confidence High
Confidence Score 15.8
NoLS Segment(s)
PositionSequenceProtein Nature
170-192MIFSKRIKARQWRHDRKKELEEQHydrophilic
260-284VFEARRERIRNKTREKERERRGEVLBasic
NLS Segment(s)
PositionSequence
264-299RRERIRNKTREKERERRGEVLKSTLKRQRRGPPAHV
Subcellular Location(s) nucl 17, cyto 5.5, cyto_mito 4.5, mito 2.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR008011  Complex1_LYR_dom  
Pfam View protein in Pfam  
PF05347  Complex1_LYR  
Amino Acid Sequences MNESYVPAESLAFRAKLAQLVSPLRRIRTRTPFFRLAAHRIPTLWSLYRGLLRNSPTEHVKFRVRLLFRENRHLTGVAKTRERLNLAYKYLDFFRKATDGDKHCQDVMLRYSRLIEMKRDKARMTRLMCEELNWLEQRRNQPIMTGSFIRPSLFNVPLPRLKPQPQATSMIFSKRIKARQWRHDRKKELEEQLADLAIERQFEEGLRRLVGFSFPTCYSGPAAAEWTQPILDAIEGIKDSQRREQVRAATPYPPELIKSVFEARRERIRNKTREKERERRGEVLKSTLKRQRRGPPAHVLAKWSPERRAMDRVARSLSEVGYVALVKRRLGFKLKDPEAGLELGEPENRPILDQVVKFIRTENKKRAIEEELTTHNSRQGSGSGMGQHVEDSVDH
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.19
2 0.2
3 0.22
4 0.23
5 0.22
6 0.24
7 0.32
8 0.35
9 0.41
10 0.43
11 0.45
12 0.5
13 0.53
14 0.56
15 0.59
16 0.65
17 0.66
18 0.7
19 0.72
20 0.68
21 0.71
22 0.67
23 0.65
24 0.63
25 0.58
26 0.51
27 0.44
28 0.45
29 0.38
30 0.37
31 0.31
32 0.26
33 0.24
34 0.26
35 0.31
36 0.32
37 0.33
38 0.33
39 0.33
40 0.36
41 0.37
42 0.38
43 0.39
44 0.4
45 0.41
46 0.41
47 0.46
48 0.43
49 0.46
50 0.5
51 0.46
52 0.46
53 0.51
54 0.55
55 0.51
56 0.59
57 0.57
58 0.51
59 0.51
60 0.48
61 0.4
62 0.39
63 0.44
64 0.39
65 0.39
66 0.38
67 0.4
68 0.43
69 0.44
70 0.4
71 0.39
72 0.4
73 0.38
74 0.4
75 0.36
76 0.34
77 0.35
78 0.35
79 0.3
80 0.24
81 0.25
82 0.24
83 0.24
84 0.27
85 0.31
86 0.32
87 0.36
88 0.39
89 0.38
90 0.36
91 0.36
92 0.33
93 0.29
94 0.3
95 0.32
96 0.28
97 0.26
98 0.27
99 0.28
100 0.31
101 0.28
102 0.3
103 0.32
104 0.4
105 0.46
106 0.48
107 0.48
108 0.5
109 0.55
110 0.55
111 0.51
112 0.49
113 0.46
114 0.48
115 0.46
116 0.41
117 0.36
118 0.29
119 0.28
120 0.23
121 0.21
122 0.19
123 0.23
124 0.28
125 0.31
126 0.33
127 0.29
128 0.3
129 0.32
130 0.32
131 0.31
132 0.28
133 0.23
134 0.22
135 0.23
136 0.21
137 0.18
138 0.18
139 0.19
140 0.17
141 0.19
142 0.19
143 0.23
144 0.27
145 0.28
146 0.29
147 0.29
148 0.32
149 0.38
150 0.41
151 0.43
152 0.41
153 0.44
154 0.41
155 0.41
156 0.38
157 0.33
158 0.32
159 0.27
160 0.3
161 0.31
162 0.35
163 0.37
164 0.46
165 0.52
166 0.57
167 0.68
168 0.74
169 0.8
170 0.84
171 0.85
172 0.81
173 0.8
174 0.78
175 0.72
176 0.65
177 0.55
178 0.47
179 0.4
180 0.33
181 0.25
182 0.17
183 0.12
184 0.08
185 0.07
186 0.06
187 0.06
188 0.06
189 0.06
190 0.08
191 0.09
192 0.1
193 0.1
194 0.1
195 0.1
196 0.1
197 0.11
198 0.1
199 0.08
200 0.1
201 0.1
202 0.13
203 0.13
204 0.14
205 0.13
206 0.13
207 0.13
208 0.1
209 0.12
210 0.1
211 0.11
212 0.1
213 0.09
214 0.09
215 0.08
216 0.08
217 0.06
218 0.04
219 0.04
220 0.04
221 0.05
222 0.05
223 0.05
224 0.08
225 0.1
226 0.11
227 0.16
228 0.24
229 0.26
230 0.29
231 0.34
232 0.39
233 0.44
234 0.47
235 0.44
236 0.41
237 0.39
238 0.37
239 0.33
240 0.26
241 0.2
242 0.17
243 0.16
244 0.12
245 0.15
246 0.21
247 0.22
248 0.26
249 0.29
250 0.32
251 0.4
252 0.45
253 0.47
254 0.5
255 0.58
256 0.64
257 0.7
258 0.77
259 0.78
260 0.83
261 0.87
262 0.87
263 0.87
264 0.88
265 0.82
266 0.79
267 0.74
268 0.7
269 0.62
270 0.6
271 0.58
272 0.5
273 0.53
274 0.53
275 0.56
276 0.54
277 0.61
278 0.62
279 0.65
280 0.71
281 0.69
282 0.72
283 0.73
284 0.74
285 0.67
286 0.62
287 0.54
288 0.53
289 0.53
290 0.46
291 0.41
292 0.41
293 0.44
294 0.43
295 0.48
296 0.46
297 0.48
298 0.5
299 0.51
300 0.47
301 0.43
302 0.41
303 0.36
304 0.3
305 0.23
306 0.18
307 0.14
308 0.12
309 0.12
310 0.11
311 0.14
312 0.16
313 0.15
314 0.19
315 0.22
316 0.25
317 0.32
318 0.35
319 0.39
320 0.49
321 0.51
322 0.52
323 0.5
324 0.48
325 0.43
326 0.39
327 0.3
328 0.2
329 0.19
330 0.15
331 0.15
332 0.14
333 0.12
334 0.15
335 0.15
336 0.15
337 0.14
338 0.17
339 0.22
340 0.22
341 0.26
342 0.3
343 0.31
344 0.3
345 0.34
346 0.39
347 0.42
348 0.51
349 0.55
350 0.59
351 0.62
352 0.65
353 0.65
354 0.62
355 0.57
356 0.52
357 0.47
358 0.44
359 0.46
360 0.46
361 0.42
362 0.39
363 0.35
364 0.32
365 0.28
366 0.24
367 0.22
368 0.21
369 0.24
370 0.23
371 0.24
372 0.23
373 0.21
374 0.2
375 0.16