Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A067S8Y2

Protein Details
Accession A0A067S8Y2    Localization Confidence Medium Confidence Score 13.3
NoLS Segment(s)
PositionSequenceProtein Nature
1-26MSSPNHSRPHNQLRRRPRVPLRISEPHydrophilic
166-191APDVVLKPRNKLKKRRREAYHEDEGLBasic
NLS Segment(s)
PositionSequence
172-182KPRNKLKKRRR
Subcellular Location(s) mito_nucl 12.166, nucl 12, mito 12
Family & Domain DBs
Amino Acid Sequences MSSPNHSRPHNQLRRRPRVPLRISEPITLPRRSTDSIVPSSAPPCKVSIAFDPRLPPSLSPRPLSLNKNESYIDDAFPWTNVAPNKFRYRHRHSASAPDIIFKRNPSFHSRLRSHDPQQSSPLTSPPLPPEPVPHVPVPYPPKTELPPPSTTSNESTQSLTVETNAPDVVLKPRNKLKKRRREAYHEDEGLQLFSQIETLFRRKSKPRPEEYATPNRLVLGSHFIPKYIPPSFDDGRVVDYRRRY
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.86
2 0.85
3 0.85
4 0.84
5 0.84
6 0.81
7 0.81
8 0.77
9 0.77
10 0.75
11 0.67
12 0.6
13 0.59
14 0.57
15 0.5
16 0.43
17 0.36
18 0.38
19 0.37
20 0.37
21 0.35
22 0.36
23 0.37
24 0.37
25 0.35
26 0.32
27 0.33
28 0.34
29 0.29
30 0.24
31 0.22
32 0.23
33 0.22
34 0.24
35 0.29
36 0.32
37 0.33
38 0.34
39 0.36
40 0.35
41 0.38
42 0.35
43 0.28
44 0.28
45 0.36
46 0.37
47 0.36
48 0.36
49 0.39
50 0.45
51 0.48
52 0.47
53 0.44
54 0.41
55 0.42
56 0.41
57 0.35
58 0.33
59 0.3
60 0.24
61 0.18
62 0.18
63 0.15
64 0.15
65 0.15
66 0.1
67 0.12
68 0.14
69 0.17
70 0.19
71 0.24
72 0.32
73 0.36
74 0.44
75 0.5
76 0.57
77 0.64
78 0.65
79 0.68
80 0.61
81 0.67
82 0.62
83 0.58
84 0.49
85 0.42
86 0.38
87 0.32
88 0.31
89 0.23
90 0.23
91 0.2
92 0.23
93 0.27
94 0.32
95 0.35
96 0.43
97 0.44
98 0.45
99 0.5
100 0.53
101 0.51
102 0.51
103 0.5
104 0.43
105 0.44
106 0.41
107 0.35
108 0.29
109 0.25
110 0.21
111 0.19
112 0.18
113 0.17
114 0.18
115 0.18
116 0.17
117 0.19
118 0.23
119 0.25
120 0.26
121 0.24
122 0.22
123 0.21
124 0.27
125 0.3
126 0.27
127 0.27
128 0.26
129 0.28
130 0.28
131 0.34
132 0.35
133 0.34
134 0.34
135 0.35
136 0.36
137 0.36
138 0.37
139 0.34
140 0.31
141 0.29
142 0.26
143 0.24
144 0.21
145 0.2
146 0.18
147 0.15
148 0.12
149 0.11
150 0.1
151 0.1
152 0.09
153 0.09
154 0.08
155 0.09
156 0.14
157 0.2
158 0.21
159 0.26
160 0.34
161 0.44
162 0.53
163 0.63
164 0.68
165 0.72
166 0.81
167 0.86
168 0.86
169 0.85
170 0.86
171 0.84
172 0.82
173 0.73
174 0.63
175 0.55
176 0.47
177 0.38
178 0.28
179 0.2
180 0.11
181 0.09
182 0.09
183 0.07
184 0.09
185 0.12
186 0.17
187 0.22
188 0.24
189 0.31
190 0.39
191 0.49
192 0.58
193 0.64
194 0.68
195 0.71
196 0.76
197 0.78
198 0.79
199 0.8
200 0.73
201 0.65
202 0.57
203 0.49
204 0.42
205 0.33
206 0.26
207 0.23
208 0.21
209 0.25
210 0.25
211 0.24
212 0.25
213 0.26
214 0.3
215 0.26
216 0.26
217 0.23
218 0.3
219 0.32
220 0.34
221 0.36
222 0.3
223 0.32
224 0.35
225 0.36