Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A067TBB6

Protein Details
Accession A0A067TBB6    Localization Confidence Low Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
2-28VEMTYGKLFRRRRLRRRWNGALTPTNVHydrophilic
NLS Segment(s)
PositionSequence
11-17RRRRLRR
Subcellular Location(s) mito 23, cyto 2
Family & Domain DBs
Amino Acid Sequences MVEMTYGKLFRRRRLRRRWNGALTPTNVVASSAGRPSCGPTTSTTSIITIHDIHYQALTKRYNRYPVGVVALSLLVGTGAAPELACSLLEYNRPHIRDPVPHLWPSSLVAVSCSIRSFRLPLLFLRYFVELWCCSYLY
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.75
2 0.84
3 0.87
4 0.92
5 0.93
6 0.91
7 0.88
8 0.86
9 0.81
10 0.73
11 0.64
12 0.55
13 0.44
14 0.35
15 0.27
16 0.2
17 0.14
18 0.13
19 0.14
20 0.13
21 0.13
22 0.14
23 0.17
24 0.19
25 0.19
26 0.18
27 0.17
28 0.25
29 0.26
30 0.28
31 0.25
32 0.22
33 0.22
34 0.22
35 0.2
36 0.14
37 0.13
38 0.14
39 0.14
40 0.13
41 0.13
42 0.14
43 0.14
44 0.18
45 0.2
46 0.2
47 0.25
48 0.28
49 0.34
50 0.33
51 0.34
52 0.31
53 0.28
54 0.29
55 0.23
56 0.2
57 0.13
58 0.12
59 0.1
60 0.08
61 0.06
62 0.02
63 0.02
64 0.02
65 0.02
66 0.02
67 0.02
68 0.02
69 0.02
70 0.03
71 0.03
72 0.03
73 0.04
74 0.05
75 0.06
76 0.11
77 0.12
78 0.18
79 0.23
80 0.25
81 0.26
82 0.3
83 0.32
84 0.33
85 0.4
86 0.42
87 0.41
88 0.41
89 0.41
90 0.37
91 0.35
92 0.31
93 0.25
94 0.18
95 0.14
96 0.13
97 0.14
98 0.15
99 0.15
100 0.14
101 0.12
102 0.13
103 0.15
104 0.16
105 0.18
106 0.22
107 0.23
108 0.25
109 0.32
110 0.32
111 0.32
112 0.32
113 0.3
114 0.25
115 0.24
116 0.26
117 0.18
118 0.21